SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330631|ref|NP_441359.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330631|ref|NP_441359.1|
Domain Number 1 Region: 190-505
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.17e-110
Family Leucine aminopeptidase, C-terminal domain 0.00000055
Further Details:      
 
Domain Number 2 Region: 17-193
Classification Level Classification E-value
Superfamily Macro domain-like 7.06e-37
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330631|ref|NP_441359.1|
Sequence length 508
Comment leucyl aminopeptidase [Synechocystis sp. PCC 6803]
Sequence
MAKWGTDSPSTEKQTAMQIRGTDYTALTWQGDALALGFFENATEITGDLTQLDDRLEGVL
RELIEEKEFKGKAGQKLVSRVGSKTPIKKLILVGLGEIEKFNSQVLGDGAAAIARLAKGE
KVKTLGVSLPQREHDPAQTAAILTEGILLALHQDNRFKSDPEDKEIKLTTVELLGLGEQS
TAIGKAEKIVSGVILAREMVAAPANEVTPLTFTEIATELAQTYGLELEVLGQTECEALGM
GAFLGVAKASELPPQFIHLTYRPANPVKKLAIIGKSLTFDSGGLNIKGAGSGIETMKMDM
GGGGATLGAAKAIAQLKPNVEIHFICAATENMISGTAMHPGDILTASNGKTIEVNNTDAE
GRLTLADALVFAEKLGVEAIVDLATLTGACIVALGDDIGGLWSPNQELADELKVAADKAG
EKFWQMPMESKYFEGLKSPIADMKNTGPRSGGSITAALFLQQFIKETPWAHLDIAGPVWT
DKQNGVHNAGATGYPVRTLVQWVLGLAE
Download sequence
Identical sequences gi|16330631|ref|NP_441359.1| gi|16330631|ref|NP_441359.1| 1148.sll2001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]