SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330637|ref|NP_441365.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330637|ref|NP_441365.1|
Domain Number 1 Region: 2-89
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000155
Family Paired domain 0.068
Further Details:      
 
Weak hits

Sequence:  gi|16330637|ref|NP_441365.1|
Domain Number - Region: 116-235
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00866
Family GABA-aminotransferase-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330637|ref|NP_441365.1|
Sequence length 282
Comment transposase [Synechocystis sp. PCC 6803]
Sequence
MAYSLDLRQRVVAYIEAGGKITEASKIYKIGKASIYRWLNRVDLSPTKVERRHRKLDWEA
LKKDVEENPDARLIDRAKKFGVRPSAVYYALKKMKINRKKKELRYRERNREERVKYYRML
RELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKGKK
DLIAPMVFTGSLNAEGFEGWLKLYLLSSLDIPSILIMDNAPIHRKTAIKELAKEAGHEVL
FLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV
Download sequence
Identical sequences P73976
gi|16330637|ref|NP_441365.1| gi|383325547|ref|YP_005386400.1| gi|383491431|ref|YP_005409107.1| gi|383322378|ref|YP_005383231.1| gi|16330637|ref|NP_441365.1| WP_010872670.1.11876 WP_010872670.1.1889 WP_010872670.1.18904 WP_010872670.1.33690 WP_010872670.1.35395 WP_010872670.1.47586 WP_010872670.1.99424 1148.sll1998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]