SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330670|ref|NP_441398.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330670|ref|NP_441398.1|
Domain Number 1 Region: 49-222
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.48e-74
Family HD domain 0.00000208
Further Details:      
 
Domain Number 2 Region: 211-427
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.62e-60
Family RelA/SpoT domain 0.0000152
Further Details:      
 
Domain Number 3 Region: 410-482
Classification Level Classification E-value
Superfamily TGS-like 4.09e-24
Family G domain-linked domain 0.023
Further Details:      
 
Domain Number 4 Region: 680-758
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000204
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330670|ref|NP_441398.1|
Sequence length 760
Comment (p)ppGpp 3'-pyrophosphohydrolase [Synechocystis sp. PCC 6803]
Sequence
MNAVAALPTPTIHTTCAQDIHDIELPQWLEDCLQQWQREIEQGQDETTAPHCLICRAFCF
AYDLHAQQRRKSGEPYIAHPVAVAGLLRDLGGDEAMIAAGFLHDVVEDTDISIEQIEALF
GEETASLVEGVTKLSKFNFSSTTEHQAENFRRMFLAMAKDIRVIVVKLADRLHNMRTLDA
LSPEKQRRIARETKDIFAPLANRLGIWRFKWELEDLSFKYLEPDSYRKIQSLVVEKRGDR
ESRLETVKDMLRFRLRDEGIEHFELQGRPKHLYGIYYKMTSQDKAFEEIYDIAALRIIVE
SKGECYRALSVVHDVFKPIPGRFKDYIGLPKPNRYQSLHTTVLGLTSRPLEIQIRTEEMH
HVAEYGIAAHWKYKESGGSENATLTSTDEKFTWLRQLLDWQSDLKDAQEYVENLKQNLFD
DDVYVFTPKGEVISLARGATPVDFAYRIHTEVGHHMKGARVNGQWLGVDTRLKNGDIVEI
VTQKNSHPSLDWLNFVVTPSARHRIRQWFKRSRRDENILRGRELLEKELGKTGLEALLKS
EPMQKTAERCNYQNVEDLLAGLGYGEITSNSVVNRLRENNVNNVKNSQSSQEVTLASSPQ
VHPPTPPATGKDNSPIAGIEGLLYHIAGCCHPLPGEPIMGVVTRGARGISIHRQGCHNLE
QMDGDRLIPVRWNPNTNNHQTYPVDIVIEAIDRVGVLKDILSRLSDNHINVRNADVKTHL
GRPAIISLKIDIHDYQQLLGIMAKIKNMSDVMDLRRVISG
Download sequence
Identical sequences L8AIG2 P74007
gi|383325581|ref|YP_005386434.1| WP_010872703.1.11876 WP_010872703.1.1889 WP_010872703.1.18904 WP_010872703.1.33690 WP_010872703.1.35395 WP_010872703.1.47586 WP_010872703.1.99424 gi|383491465|ref|YP_005409141.1| SgR168 1148.slr1325 gi|383322412|ref|YP_005383265.1| gi|16330670|ref|NP_441398.1| gi|16330670|ref|NP_441398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]