SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330729|ref|NP_441457.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330729|ref|NP_441457.1|
Domain Number 1 Region: 7-218
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.55e-146
Family D-ribulose-5-phosphate 3-epimerase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330729|ref|NP_441457.1|
Sequence length 230
Comment ribulose-phosphate 3-epimerase [Synechocystis sp. PCC 6803]
Sequence
MSKNIVVAPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVDAIRPL
TKKTLDVHLMIVEPEKYVEDFAKAGADIISVHVEHNASPHLHRTLCQIRELGKKAGAVLN
PSTPLDFLEYVLPVCDLILIMSVNPGFGGQSFIPEVLPKIRALRQMCDERGLDPWIEVDG
GLKPNNTWQVLEAGANAIVAGSAVFNAPNYAEAIAGVRNSKRPEPQLATV
Download sequence
Identical sequences L8AK30 P74061
gi|383325640|ref|YP_005386493.1| cath|current|1tqjA00/3-223 cath|current|1tqjB00/3-224 cath|current|1tqjC00/3-225 cath|current|1tqjD00/3-223 cath|current|1tqjE00/3-223 cath|current|1tqjF00/3-223 gi|383322471|ref|YP_005383324.1| 1tqjA 1tqj_A 1tqj_B 1tqj_C 1tqj_D 1tqj_E 1tqj_F WP_010872762.1.11876 WP_010872762.1.1889 WP_010872762.1.18904 WP_010872762.1.33690 WP_010872762.1.35395 WP_010872762.1.47586 WP_010872762.1.99424 gi|383491524|ref|YP_005409200.1| gi|16330729|ref|NP_441457.1| gi|16330729|ref|NP_441457.1| 1148.sll0807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]