SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330738|ref|NP_441466.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330738|ref|NP_441466.1|
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.27e-50
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000118
Further Details:      
 
Domain Number 2 Region: 4-55
Classification Level Classification E-value
Superfamily UBA-like 6.96e-20
Family TS-N domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16330738|ref|NP_441466.1|
Sequence length 218
Comment elongation factor Ts [Synechocystis sp. PCC 6803]
Sequence
MAEITAQLVKELREKTGAGMMDCKKALKENEGDLEKSIEWLRQKGIASADKKSGRTAAEG
LVHSYIHFGGRIGVLVEVNCETDFVARGDRFKDLVNDVAMQIAACPNVEYVSVADIPQEM
VAKEKEIEMGRDDLGKKPANIKEKIVQGRIDKRLKELSLLDQPYIKDQNLTIEELVKQAI
AELGENIQVRRFIRFNLGEGIEKAETNFAEEVAAAAKG
Download sequence
Identical sequences L8AKA7 P74070
1148.sll1261 gi|16330738|ref|NP_441466.1| gi|383322480|ref|YP_005383333.1| gi|383325649|ref|YP_005386502.1| gi|16330738|ref|NP_441466.1| gi|383491533|ref|YP_005409209.1| WP_010872771.1.11876 WP_010872771.1.1889 WP_010872771.1.18904 WP_010872771.1.33690 WP_010872771.1.35395 WP_010872771.1.47586 WP_010872771.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]