SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330784|ref|NP_441512.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330784|ref|NP_441512.1|
Domain Number 1 Region: 3-256
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.57e-79
Family Histidine biosynthesis enzymes 0.000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16330784|ref|NP_441512.1|
Sequence length 261
Comment imidazole glycerol phosphate synthase subunit HisF [Synechocystis sp. PCC 6803]
Sequence
MTLAKRILPCLDVNAGRVVKGINFVDLQDAGDPVELARAYNEAGADELVFLDITATHEQR
DTIIDVVYRTAEEVFIPLTVGGGISTLEHIKNLLRAGADKVSVNSSAVRDPDFISRASDR
FGRQCIVVAIDARRRLDADNPGWDVYVRGGRENTGLDAIAWAEEVAKRGAGELLVTSMDG
DGTQAGYDLALTAAIAERVEIPVIASGGAGNCQHVYEAFTEGKAEAALLASLLHYGQLTI
GELKTFLEARQIPVRHTAVCG
Download sequence
Identical sequences L8AQN6 P74106
gi|16330784|ref|NP_441512.1| gi|383491579|ref|YP_005409255.1| 1148.sll1893 gi|16330784|ref|NP_441512.1| gi|383325695|ref|YP_005386548.1| gi|383322526|ref|YP_005383379.1| WP_010872815.1.11876 WP_010872815.1.1889 WP_010872815.1.18904 WP_010872815.1.33690 WP_010872815.1.35395 WP_010872815.1.47586 WP_010872815.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]