SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16330992|ref|NP_441720.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16330992|ref|NP_441720.1|
Domain Number 1 Region: 1-322,435-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.66e-57
Family FAD-linked reductases, N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16330992|ref|NP_441720.1|
Sequence length 489
Comment zeta-carotene desaturase [Synechocystis sp. PCC 6803]
Sequence
MRVAIVGAGLAGMATAVELVDAGHEVELYEARSFIGGKVGSWVDGDGNHIEMGLHVFFGC
YYNLFNLMEKVGAKQNLRLKEHTHTFVNQGGRIGELDFRFLTGAPFNGLKAFFTTSQLDT
KDKIANSIALATSPIVRGLVDFDGAMKTIRDLDRISFAEWFLSKGGNEGSLKKMWDPIAY
ALGFIDTENISARCMLTIFQLFAARTEASVLRMLEGSPQEYLHKPIQEYLEQRGTKFYTR
HKVKEIKTKVTDGETRVTGLIINDGVETKTVTADAYVAACDVPGIKNLLPENWRTQWDFF
NKIYYLDTVPVATVQLRFDGWVTEMNDPAKRKQLEQAFGLDNLLYTSDAEFSCFADLALT
SPADYYRPGEGSLLQLVLTPGDPFMKESNEAIAYRVLKQVKALFPSAADLNMTWYSVIKL
AQSLYREAPGMDLFRPSQATPIANFFLAGSYTQQDYIDSMEGATLSGRQAAQAILANQAR
LQTAVLASQ
Download sequence
Identical sequences P74306
WP_010873021.1.11876 WP_010873021.1.1889 WP_010873021.1.18904 WP_010873021.1.33690 WP_010873021.1.35395 WP_010873021.1.47586 WP_010873021.1.99424 NYSGRC-FDAO-BAA18400 SgR74 1148.slr0940 gi|383325904|ref|YP_005386757.1| gi|383322735|ref|YP_005383588.1| gi|383491788|ref|YP_005409464.1| gi|16330992|ref|NP_441720.1| gi|16330992|ref|NP_441720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]