SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331102|ref|NP_441830.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331102|ref|NP_441830.1|
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ribosomal protein S16 9.16e-27
Family Ribosomal protein S16 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331102|ref|NP_441830.1|
Sequence length 82
Comment 30S ribosomal protein S16 [Synechocystis sp. PCC 6803]
Sequence
MIKLRLKRFGKKREVSYRIVAMHSTTRRDGRPLEELGFYNPRTDETRLDVPAIVKRLKEG
AQPTDTVRSILTKAQVFEQLKA
Download sequence
Identical sequences L8ATG2 P74410
gi|383322845|ref|YP_005383698.1| WP_010873131.1.11876 WP_010873131.1.1889 WP_010873131.1.18904 WP_010873131.1.33690 WP_010873131.1.35395 WP_010873131.1.47586 WP_010873131.1.99424 gi|383326014|ref|YP_005386867.1| 1148.ssr0482 gi|383491898|ref|YP_005409574.1| gi|16331102|ref|NP_441830.1| gi|16331102|ref|NP_441830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]