SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331193|ref|NP_441921.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331193|ref|NP_441921.1|
Domain Number - Region: 72-146
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00266
Family Retroviral integrase, catalytic domain 0.049
Further Details:      
 
Domain Number - Region: 2-116
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0148
Family GABA-aminotransferase-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331193|ref|NP_441921.1|
Sequence length 164
Comment transposase [Synechocystis sp. PCC 6803]
Sequence
MLRELIKLYGSQAIVYIDESGFEAIQACIYAWSKKGKKVYGDRQGKRGVRENLVAGRRKG
KKDLIAPMVFTGSLNAEGFEGWLKLYLLPSLDIPSILIMDNAPIHRKTAIKELAKEAGHE
VLFLPKYSPDLNDIEHDFSALKRARMYAPIDTSLDEIIRSYCGV
Download sequence
Identical sequences L8ASR6 Q55696
gi|38505773|ref|NP_942393.1|NC_005230 gi|451816776|ref|YP_007453043.1|NC_020287 gi|16329277|ref|NP_440005.1| gi|16329556|ref|NP_440284.1| gi|16330390|ref|NP_441118.1| gi|16330494|ref|NP_441222.1| gi|16330572|ref|NP_441300.1| gi|16330642|ref|NP_441370.1| gi|16330742|ref|NP_441470.1| gi|16330899|ref|NP_441627.1| gi|16331193|ref|NP_441921.1| gi|16331427|ref|NP_442155.1| gi|38505773|ref|NP_942393.1| gi|383324187|ref|YP_005385040.1| gi|383324467|ref|YP_005385320.1| gi|383325300|ref|YP_005386153.1| gi|383325404|ref|YP_005386257.1| gi|383325482|ref|YP_005386335.1| gi|383325552|ref|YP_005386405.1| gi|383325653|ref|YP_005386506.1| gi|383325810|ref|YP_005386663.1| gi|383326105|ref|YP_005386958.1| gi|383326338|ref|YP_005387191.1| gi|383490071|ref|YP_005407747.1| gi|383490351|ref|YP_005408027.1| gi|383491184|ref|YP_005408860.1| gi|383491288|ref|YP_005408964.1| gi|383491366|ref|YP_005409042.1| gi|383491436|ref|YP_005409112.1| gi|383491537|ref|YP_005409213.1| gi|383491694|ref|YP_005409370.1| gi|383491989|ref|YP_005409665.1| gi|383492222|ref|YP_005409898.1| gi|16329277|ref|NP_440005.1| gi|16329556|ref|NP_440284.1| gi|16330390|ref|NP_441118.1| gi|16330494|ref|NP_441222.1| gi|16330572|ref|NP_441300.1| gi|16330642|ref|NP_441370.1| gi|16330742|ref|NP_441470.1| gi|16330899|ref|NP_441627.1| gi|16331193|ref|NP_441921.1| gi|16331427|ref|NP_442155.1| gi|38505773|ref|NP_942393.1| 1148.sll0201 1148.sll0651 1148.sll0700 1148.sll1257 1148.sll1437 1148.sll1984 1148.slr0857 1148.slr1716 1148.slr1937 1148.slr2113 1148.slr7105 gi|383321017|ref|YP_005381870.1| gi|383321297|ref|YP_005382150.1| gi|383322131|ref|YP_005382984.1| gi|383322235|ref|YP_005383088.1| gi|383322313|ref|YP_005383166.1| gi|383322383|ref|YP_005383236.1| gi|383322484|ref|YP_005383337.1| gi|383322641|ref|YP_005383494.1| gi|383322936|ref|YP_005383789.1| gi|383323169|ref|YP_005384022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]