SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331238|ref|NP_441966.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331238|ref|NP_441966.1|
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000141
Family 7-Fe ferredoxin 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331238|ref|NP_441966.1|
Sequence length 81
Comment photosystem I subunit VII [Synechocystis sp. PCC 6803]
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A068MS78 A0A0A1VPV2 A0A2H6L5A4 B7KFK8 I4G550 L8AST2 P32422
gi|383492034|ref|YP_005409710.1| gi|383326150|ref|YP_005387003.1| gi|16331238|ref|NP_441966.1| gi|218441872|ref|YP_002380201.1| gi|16331238|ref|NP_441966.1| gi|383322981|ref|YP_005383834.1| 4kt0_C 4l6v_3 4l6v_C 4l6v_c 5oy0_c 1148.ssl0563 65393.PCC7424_4980 cath|current|4kt0C00/2-81 cath|current|4l6v300/2-81 cath|current|4l6vC00/2-81 cath|current|4l6vc00/2-81 WP_002764973.1.10452 WP_002764973.1.11876 WP_002764973.1.1889 WP_002764973.1.18904 WP_002764973.1.33690 WP_002764973.1.35395 WP_002764973.1.47586 WP_002764973.1.5567 WP_002764973.1.63236 WP_002764973.1.6707 WP_002764973.1.709 WP_002764973.1.75496 WP_002764973.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]