SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331336|ref|NP_442064.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331336|ref|NP_442064.1|
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.000238
Family Transcriptional factor domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16331336|ref|NP_442064.1|
Sequence length 161
Comment NrdR family transcriptional regulator [Synechocystis sp. PCC 6803]
Sequence
MQCPHCQHHNSRVLESRSSEGGQSIRRRRECLECKHRFTTYERLELLPVTVIKQDGERQA
FDRSKLLRGMVRACEKTDINFQRLEHIVEEIEANLQQQPKREIHSEAIGQMVLQYLRQES
EVAYIRFASVYGRFQGIADFVDTLEQLQREQYPERQYLTMT
Download sequence
Identical sequences Q55622
1148.slr0780 gi|16331336|ref|NP_442064.1| gi|383323078|ref|YP_005383931.1| gi|383492131|ref|YP_005409807.1| gi|383326247|ref|YP_005387100.1| gi|16331336|ref|NP_442064.1| WP_010873363.1.11876 WP_010873363.1.1889 WP_010873363.1.18904 WP_010873363.1.33690 WP_010873363.1.35395 WP_010873363.1.47586 WP_010873363.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]