SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331355|ref|NP_442083.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331355|ref|NP_442083.1|
Domain Number 1 Region: 6-160
Classification Level Classification E-value
Superfamily RNase III domain-like 3.66e-36
Family RNase III catalytic domain-like 0.00086
Further Details:      
 
Domain Number 2 Region: 118-232
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.29e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331355|ref|NP_442083.1|
Sequence length 244
Comment ribonuclease III [Synechocystis sp. PCC 6803]
Sequence
MSLLPHRQTQLKALLRRLGLTDNTPVDWNLVDLALTHASQSPEQNYQQLEFVGDAVVRLA
SAEVLMKHYPQTSVGEMSALRAILVSDRTLAGWGELYGLDRFLWITPAVLADKNGRVSLM
ADSFEALLGALYLSVGDLSLIRPWLSEHLLAKATEIRQDPALHNYKEALQAWTQAHYKCL
PEYRVEPLDQNLPQQSGFQATVWLGDQPLGSGSGSSKKSAEQAAAQQAYQDFIAKEILPM
PKIN
Download sequence
Identical sequences L8ASV9 Q55637
WP_010873382.1.11876 WP_010873382.1.1889 WP_010873382.1.18904 WP_010873382.1.33690 WP_010873382.1.35395 WP_010873382.1.47586 WP_010873382.1.99424 gi|16331355|ref|NP_442083.1| 1148.slr0346 gi|383326265|ref|YP_005387118.1| gi|383323096|ref|YP_005383949.1| gi|383492149|ref|YP_005409825.1| gi|16331355|ref|NP_442083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]