SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331356|ref|NP_442084.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331356|ref|NP_442084.1|
Domain Number 1 Region: 173-390
Classification Level Classification E-value
Superfamily YrdC/RibB 2.62e-52
Family YrdC-like 0.0015
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Acylphosphatase/BLUF domain-like 5.67e-22
Family Acylphosphatase-like 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|16331356|ref|NP_442084.1|
Domain Number - Region: 480-566,662-731
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 0.00214
Family BadF/BadG/BcrA/BcrD-like 0.055
Further Details:      
 
Domain Number - Region: 127-167
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0935
Family PhnA zinc-binding domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331356|ref|NP_442084.1|
Sequence length 767
Comment HypF family transcriptional regulator [Synechocystis sp. PCC 6803]
Sequence
MLKTVAIQVQGRVQGVGFRPFVYTLAQEMGLNGWVNNSTQGATVVITADEKAIADFTERL
TKTLPPPGLIEQLAVEQLPLESFTNFTIRPSSDGPKTASILPDLSTCSACLTELFDPSDR
RYLYPFINCTHCGPRYTIIEALPYDRCRTTMARFRQCTDCEREYKQPGDRRFHAQPNACP
RCGPQLAFWNRQGQVIAEANEALNFAVDNLKVGNIIAIKGLGGFHLCCDATDFEAVEKLR
LRKHRPDKPLAVMYGNLGQIVEHYQPNNLEVELLQSAAAPIVLLNKKKQLILVENIAPGN
PRVGVMLAYTPLHHLLLKKLKKPMVATSGNLAGEQICIDNIDALTRLQNIADGFLVHDRP
IVCPVDDSVVQIVAGKPLFLRRARGYAPQPITLPKPTQKKLLAMGGHYKNTVAIAKQNQA
YVSQHLGDLNSAPTYQNFEEAIAHLSQLYDFSPQEIVADLHPDYFSHQYAENQALPVTFV
QHHYAHILAVMAEHGVMEESVLGIAWDGTGYGMDGTIWGGEFLKITQGTWQRIAHLQPFH
LLGNQQAIKYPHRIALALLWPTFGDDFSADSLGNWLNFNNGFKNKINSRLNQDLNNKNLR
QLWQRGQAPLTSSMGRLFDGIATLIGLINEVTFEGQAAIALEAQIMPNLTEEYYPLTLNN
KEKKLAVDWRPLIKAITTEDRSKTNLIATKFHNSLVNLIITIAQQQGIEKVALGGGCFQN
CYLLASTITALKKAGFSPLWPRELPPNDGAICMGQLLAKIQARQYIC
Download sequence
Identical sequences L8ASI7 Q55638
WP_010873383.1.11876 WP_010873383.1.1889 WP_010873383.1.18904 WP_010873383.1.33690 WP_010873383.1.35395 WP_010873383.1.47586 WP_010873383.1.99424 gi|383323097|ref|YP_005383950.1| 1148.sll0322 gi|16331356|ref|NP_442084.1| gi|383492150|ref|YP_005409826.1| gi|16331356|ref|NP_442084.1| gi|383326266|ref|YP_005387119.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]