SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331421|ref|NP_442149.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331421|ref|NP_442149.1|
Domain Number 1 Region: 342-494
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000157
Family HD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16331421|ref|NP_442149.1|
Sequence length 722
Comment glycyl-tRNA synthetase subunit beta [Synechocystis sp. PCC 6803]
Sequence
MPLQTFLFEIGTEELPADFVRSAITQWQGLIPPGLAAEFLQPESVEIYGTPRRLAVLIKG
LPECQPDRLEEIKGPPASAAFKDGQPTPAALGFAKKQGVNPEDFEIRSTPKGDFIFVNKQ
LQGQASRDLLPKLALSWLKALDGRRFMRWGDGDWRFPRPIRWLVCLLDDQVLPLQIDNGS
TTLVGDRLSRGHRILHPADVSLEHGQNYLAQLKTAGVVVDPQERRAMIEQQITTQAATLE
GEAIIYEDLLDEVEQLVEYPTAVLGKFDQEFLSLPREVTTTVMVTHQRYFPVVDKDGRLL
PHFITIANGDPSKGDIIAAGNGRVIRARLADAKFFYQADCDDSLDSYLPQLETVTFQEEL
GTMRDKVDRIMEMAAAIADQLGVTEQQRGEIDSTAMLCKADLVTQMVYEFPELQGIMGEK
YALVSGESAAVAQGIVEHYLPRHQDDDLPQGLPGQVVGMADRLDTLVSIFGLGLLPTGSS
DPFALRRAANAVINVAWAASLEINLLELLTQGCRDFVTSHPDKTSPLQALKTFFLQRLQT
LLQDEQGIDYDLVNAVLGNGETNCDEAQSRLHDRLLADLQDVKERAQYLQELRDNGHLDA
IYPTVNRSAKLASKGTLPTDQLDPRPVIQAPQLVQDSEKAVYQALLAIYPKAVEVQESRD
YETLVNALHELAPTVAEFFDGPDSVLVMAENDELRQNRLNLLGLIRNYALILGDFGAIVK
GI
Download sequence
Identical sequences L8ASQ6 Q55690
1148.slr0220 gi|16331421|ref|NP_442149.1| gi|16331421|ref|NP_442149.1| gi|383492215|ref|YP_005409891.1| gi|383326331|ref|YP_005387184.1| WP_010873446.1.11876 WP_010873446.1.1889 WP_010873446.1.18904 WP_010873446.1.33690 WP_010873446.1.35395 WP_010873446.1.47586 WP_010873446.1.99424 gi|383323162|ref|YP_005384015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]