SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331515|ref|NP_442243.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|16331515|ref|NP_442243.1|
Domain Number - Region: 90-158
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.059
Family Exodeoxyribonuclease V beta chain (RecB), C-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331515|ref|NP_442243.1|
Sequence length 240
Comment hypothetical protein slr0479 [Synechocystis sp. PCC 6803]
Sequence
MTAPYFSLSQGHLQLLSVCPPQFQRRYWEQLGGLLEPQRQVKTEWGQNFHQLVQQWTLGL
PLETLAAQSLDPQDVSLLDSLKNLIATVPALHLPPGQRQAEHQRTLARDDVLLTVVYDLL
VLTPEQGEIFDWKTYPQPAKPEKLHHHWQTKLYLYVLAETSSYSPEQLSMTYWFVQSPEK
IQHYTITYNEAQHRATERELTDLLQQFRQGLAAWHRHRTPLAHRHNCNRCPYHDQFFPPD
Download sequence
Identical sequences L8AS45 Q55173
1148.slr0479 gi|16331515|ref|NP_442243.1| gi|383326426|ref|YP_005387280.1| gi|16331515|ref|NP_442243.1| gi|383492310|ref|YP_005409987.1| gi|383323257|ref|YP_005384111.1| WP_010873540.1.11876 WP_010873540.1.1889 WP_010873540.1.18904 WP_010873540.1.33690 WP_010873540.1.35395 WP_010873540.1.47586 WP_010873540.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]