SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331575|ref|NP_442303.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331575|ref|NP_442303.1|
Domain Number 1 Region: 19-190,234-435
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.93e-63
Family HD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331575|ref|NP_442303.1|
Sequence length 440
Comment dGTP triphosphohydrolase [Synechocystis sp. PCC 6803]
Sequence
MEWQQLLSRKRLGKQQLEEHQFERTSFLKDYDRIVYSTAFRRLKDKTQVFPLSKNADVRT
RLIHSLEVSCVGRSLGRMVGDQIIKRHQLQAIEAADFGDILSAACLAHDIGNPPFGHAGE
DAIQTAFQKWYARKNRSGALINPLEKADFDRFEGNAQGFRILTRLGLPHRPGGLQLTCAT
LATFAKYPRESFIPQRTLARHPGKSLQKYGFFQAEKDLFTEVAETVGLIGRSPKVAWWCR
HPLTFLMEAADDLCYSIVDLEDGFHMGYLPFAAVQDKLQSIADIDLNQYEGSPAETIKRL
RAKAINRLVKEVAQLFLDHEPDILAGKFDQSLVELSRFSPQLKEIETMTTNAVFHHPNVV
RIKIAGFEVLGDLLTDFLTSVLEKQPRPKGKLLKFMLPPEHQIAPDEDNYSKILKVTDYI
AGMTDLQATLLYQQLRGISL
Download sequence
Identical sequences L8AR77 Q55731
gi|383492370|ref|YP_005410047.1| WP_010873600.1.11876 WP_010873600.1.1889 WP_010873600.1.18904 WP_010873600.1.33690 WP_010873600.1.35395 WP_010873600.1.47586 WP_010873600.1.99424 1148.sll0398 gi|383326486|ref|YP_005387340.1| gi|383323317|ref|YP_005384171.1| gi|16331575|ref|NP_442303.1| gi|16331575|ref|NP_442303.1| NYSGXRC-10395e

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]