SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331836|ref|NP_442564.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331836|ref|NP_442564.1|
Domain Number 1 Region: 583-682,709-740
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000012
Family HD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331836|ref|NP_442564.1|
Sequence length 811
Comment hypothetical protein slr0104 [Synechocystis sp. PCC 6803]
Sequence
MKAIFALRQAVASQLKKSTASSHPLPRTTASTSQDETIWQKIHRSRFVRIAHPPVMLGIT
VVSLTGVVGYRFYNQPQLSVGTESPYTIYAPEDGSFVDERTTEEKRKEVRAGTIPRLQRD
NELTAQLKQERSQYLDAINQLRYLAGTFPYIDTKIFTLEQQHLLRSLGPGEWQQLEDYIS
YGQPLPMASPQLAKLQQLFDQQKATTSPETMAGLLTSIRTAQDRYGRVTARLAEVKADRQ
ITNNQIGALKLDGPTWQTTQQTIIQVHDRILTQGLPAGITAPLLGETVQLHLRNILPPQA
HQVAENSLNNLLKDKYNLTVDKEATKNLAEKAVLAMENVKVSAEKNSVIVRAGEVITQEQ
FVLLDGYGLSQRQVNWQGLLRTAGLVGGALIIFCGVSRRIHRPLRRRDHILLCLLSVSTP
VLFLLDPVYNNLPAISLLTSSFYGPTLAITQVVLVGGLSAFAMESIVWEYLLGSAAAALL
AGMIASKLRSRDELALLGVGVGATQGIVYLFTYLIVNASAVTIIWYTALPSAIVYGLLGL
AWSAMAIGVSPYLERLFDVVTPTRLVELSNPNCPLLQRLAKEAPGTFQHTLFVACLAESA
ARELRCNVELVRTGTLYHDIGKMHDPLGFIENQMGGPNKHDEINDPYVSVDIIKKHVSEG
LVMARRYGLPQVVRDFIPEHQGQMLISYFYIQAKEAAERAGEPPVNEEEFRYTGPIPQSR
ETGIVMLADSCEAALRSLREANPETAMAMVNRIFKARWRDNQLQDSGLKYEELPIIADVF
VRVWQQFHHQRIAYPKAALDVQVTSPSTTRF
Download sequence
Identical sequences P54371
gi|383326748|ref|YP_005387602.1| 1148.slr0104 gi|383492632|ref|YP_005410309.1| WP_010873862.1.11876 WP_010873862.1.1889 WP_010873862.1.18904 WP_010873862.1.33690 WP_010873862.1.35395 WP_010873862.1.47586 WP_010873862.1.99424 gi|16331836|ref|NP_442564.1| gi|16331836|ref|NP_442564.1| gi|383323579|ref|YP_005384433.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]