SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16331975|ref|NP_442703.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16331975|ref|NP_442703.1|
Domain Number 1 Region: 798-1179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.97e-126
Family PFOR PP module 0.0000000164
Further Details:      
 
Domain Number 2 Region: 418-669
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.09e-82
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.000000342
Further Details:      
 
Domain Number 3 Region: 6-259
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.35e-75
Family PFOR Pyr module 0.0000000747
Further Details:      
 
Domain Number 4 Region: 261-414
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 1.08e-48
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.00000916
Further Details:      
 
Domain Number 5 Region: 666-839
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.17e-25
Family Ferredoxin domains from multidomain proteins 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16331975|ref|NP_442703.1|
Sequence length 1199
Comment pyruvate oxidoreductase [Synechocystis sp. PCC 6803]
Sequence
MSLPTYATLDGNEAVARVAYLLSEVIAIYPITPSSPMGEWSDAWAAEHRPNLWGTVPLVV
EMQSEGGAAGTVHGALQSGALTTTFTASQGLMLMLPNMHKIAGELTAMVLHVAARSLAAQ
GLSIFGDHSDVMAARNTGFAMLSSNSVQEAHDFALIATATSFATRIPGLHFFDGFRTSHE
EQKIELLPQEVLRGLIKDEDVLAHRGRALTPDRPKLRGTAQNPDVYFQARETVNPFYASY
PNVLEQVMEQFGQLTGRHYRPYEYCGHPEAERVIVLMGSGAETAQETVDFLTAQGEKVGL
LKVRLYRPFAGDRLVNALPKTVQKIAVLDRCKEPGSIGEPLYQDVLTAFFEAGMMPKIIG
GRYGLSSKEFTPAMVKGVLDHLNQTNPKNHFTVGINDDLSHTSIDYDPSFSTEADSVVRA
IFYGLGSDGTVGANKNSIKIIGEDTDNYAQGYFVYDSKKSGSVTVSHLRFGPNPILSTYL
ISQANFVACHQWEFLEQFEVLEPAVDGGVFLVNSPYGPEEIWREFPRKVQQEIIDKNLKV
YTINANDVARDAGMGRRTNTVMQTCFFALAGVLPREEAIAKIKQSVQKTYGKKGQEIVEM
NIKAVDSTLAHLYEVSVPETVSDDAPAMRPVVPDNAPVFVREVLGKIMARQGDDLPVSAL
PCDGTYPTATTQWEKRNVGHEIPVWDPDVCVQCGKCVIVCPHAVIRGKVYEEAELANAPV
SFKFTNAKDHDWQGSKFTIQVAPEDCTGCGICVDVCPAKNKSQPRLRAINMAPQLPLREQ
ERENWDFFLDLPNPDRLSLNLNKISHQQMQEPLFEFSGACAGCGETPYLKLVSQLFGDRM
LVANATGCSSIYGGNLPTTPWAQNAEGRGPAWSNSLFEDNAEFGLGFRVAIDKQTEFAGE
LLKTFAGELGDSLVSEILNNAQTTEADIFEQRQLVEQVKQRLQNLETPQAQMFLSVADYL
VKKSVWIIGGDGWAYDIGYGGLDHVLASGRNVNILVMDTEVYSNTGGQASKATPRAAVAK
FAAGGKPSPKKDLGLMAMTYGNVYVASIAMGAKNEQSIKAFMEAEAYPGVSLIIAYSHCI
AHGINMTTAMNHQKELVDSGRWLLYRYNPLLADEGKNPLQLDMGSPKVAIDKTVYSENRF
AMLTRSQPEEAKRLMKLAQGDVNTRWAMYEYLAKRSLGGEINGNNHGVSPSPEVIAKSV
Download sequence
Identical sequences L8AQ11 P52965
WP_010873998.1.11876 WP_010873998.1.1889 WP_010873998.1.18904 WP_010873998.1.33690 WP_010873998.1.35395 WP_010873998.1.47586 WP_010873998.1.99424 gi|16331975|ref|NP_442703.1| gi|383326887|ref|YP_005387741.1| gi|16331975|ref|NP_442703.1| gi|383323718|ref|YP_005384572.1| 1148.sll0741 gi|383492771|ref|YP_005410448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]