SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332022|ref|NP_442750.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332022|ref|NP_442750.1|
Domain Number 1 Region: 231-404
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-45
Family Histidine kinase 0.00093
Further Details:      
 
Domain Number 2 Region: 160-241
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000151
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 125-173
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000628
Family HAMP domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332022|ref|NP_442750.1|
Sequence length 405
Comment sensory transduction histidine kinase [Synechocystis sp. PCC 6803]
Sequence
MCYRQMGARGSKPLLFLNDPPLWALLRSANLNPMAKLSLGSRLFLSHMLVMLVGLGSFVS
LAKISSPRMFVLRLEELESQGFITVRSAKTYLIRGFETAWNRSSLWAIIFGASAAGGLSF
LAADRIMQPLDRLKLATKNLAEGDLQSRMPPSDIPELEELGQSFNRMADSLENVEQQRRE
LVSDLTHELRSPLTVVRGYLEQLAEGTIAGDPELYQRLVGETRRLERLTVDLQELSKVEA
GYLSIQRQPLDLYPLLAKLQQRFADQLLEDGPELILAVQPPLPTVLADPDRAEQILVNLI
GNAVRYTPSGAITIDAYLCTNRKDMEKENLLWVTVTDTGIGIAEGDLPYVFERFWRADKS
RSRYSGGTGLGLAIAKRLVELQGGSLTVTSTLGQGSEFRFSLPLV
Download sequence
Identical sequences Q55475
gi|16332022|ref|NP_442750.1| gi|16332022|ref|NP_442750.1| 1148.slr0533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]