SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332064|ref|NP_442792.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332064|ref|NP_442792.1|
Domain Number 1 Region: 39-292
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2e-86
Family Tryptophan biosynthesis enzymes 0.0000083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332064|ref|NP_442792.1|
Sequence length 295
Comment indole-3-glycerol phosphate synthase [Synechocystis sp. PCC 6803]
Sequence
MEIRRRPPNPPIKVDILQYQIKHPEAAPRHILEEIVWHKEKEVAQRRELVPLVKLQSLVK
DMTPPLDFVGALRQSPRQPALIAEVKKASPSKGIIRADFDPVAIAKAYEAGGANCLSVLT
DEKFFQGSFENLQLVRSAVQLPLLCKEFIIYPYQIYLARSRGADAVLLIAAILSDKDLRY
FLKIIEGLGMAALVEVHTLEEMDRVLALDGVQLIGVNNRNLQTFTVDLQTTEDLFAQRRE
QLTQGDITLVSESGIYELADLQRLQQAGARAVLVGESLVKQPDPQQAIAALYGEV
Download sequence
Identical sequences L8APP7 Q55508
gi|383323807|ref|YP_005384661.1| 1148.slr0546 gi|383326976|ref|YP_005387830.1| gi|16332064|ref|NP_442792.1| gi|383492860|ref|YP_005410537.1| gi|16332064|ref|NP_442792.1| WP_010874086.1.11876 WP_010874086.1.1889 WP_010874086.1.18904 WP_010874086.1.33690 WP_010874086.1.35395 WP_010874086.1.47586 WP_010874086.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]