SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332067|ref|NP_442795.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332067|ref|NP_442795.1|
Domain Number 1 Region: 78-425
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-74
Family Extended AAA-ATPase domain 0.0000000116
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000107
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332067|ref|NP_442795.1|
Sequence length 445
Comment ATP-dependent protease ATP-binding subunit ClpX [Synechocystis sp. PCC 6803]
Sequence
MPKYDSHLKCSFCGKSQEQVRKLIAGPGVYICDECVELCNDILDEELLDVPPASTGERDG
TGQKQKKSGQPRRRLTLEELPKPTAIKQYLDEYVIGQDEAKKVLSVAVYNHYKRLNLLER
NQEIDPGDAVELQKSNILLVGPTGSGKTLLAQTLAKILEVPFAVADATTLTEAGYVGEDV
ENILLRLLQVADLDVEEAQRGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKMLEGT
VANVPPQGGRKHPYQDCIQIDTSNILFICGGAFVGLEKVIEQRFGKKSMGFVRPGEGPSK
EKRTADVLRQAEPDDLVKFGLIPEFIGRIPVMACLNPLDEDALIAILTQPRNAIVKQYQT
LLGMDHVELDFQPDAVRAIATEAHRRKTGARALRGIVEELMLDVMYELPSREDLTHCLIT
REMVEKRSTAELLLHPSSLPKPESA
Download sequence
Identical sequences L8ALK8 Q55510
gi|383492863|ref|YP_005410540.1| gi|383326979|ref|YP_005387833.1| gi|383323810|ref|YP_005384664.1| WP_010874089.1.11876 WP_010874089.1.1889 WP_010874089.1.18904 WP_010874089.1.33690 WP_010874089.1.35395 WP_010874089.1.47586 WP_010874089.1.99424 gi|16332067|ref|NP_442795.1| gi|16332067|ref|NP_442795.1| 1148.sll0535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]