SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332121|ref|NP_442849.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332121|ref|NP_442849.1|
Domain Number 1 Region: 426-631
Classification Level Classification E-value
Superfamily PP2C-like 0.000017
Family PP2C-like 0.02
Further Details:      
 
Weak hits

Sequence:  gi|16332121|ref|NP_442849.1|
Domain Number - Region: 330-376
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00523
Family HAMP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332121|ref|NP_442849.1|
Sequence length 633
Comment hypothetical protein sll1365 [Synechocystis sp. PCC 6803]
Sequence
MEPVTVGQKVLKPAVGLINQLHYPQKFALISVCFLLPLGLAIFLLLSEIQGQIQFAQLEQ
QGLAYLGPLQQLQQTVLVQPLISLGPNHWRSPVDQLAQVQERWGKKLATETNYGDLEQVL
SQVTDRSQDTSEQILQAIAVLRTQVGNQSNLILDPDLDSYYLMEALLLKLPQLQTDLAQL
GTIITAHSGPGLSPAEESQVLVIKAQLAQLKTSLVKNLGVAFTHNARQQLQPRVINSLNG
LTTVLEELEQSLTKVITGQIKLNDAQLNQQSQWGLLNSLHFWRVLSPELDQLLSERIQRF
QQRQWLLSTFVLATLAIAVYLFWGFYASVMATIASLSSAAEKMVAGSETKAVELQTQDEM
AEVVHAFNTVADALCRLTEKLQDENLRLEAEIDITRQLQQMLMPSEQELAAVAGLEIAGF
MESATEVGGDYYDVLQTNGQVRISIGDVTGHDLESSLVMIMAQTALRTLLEHGVTDPVKL
LSAMNRTIYENTRRMGSSKNMTLSVLQYEAGLIRLSGQHEEVLIIRSNGATEQIDTFELG
FPLGLEQDISAFVTEREITLNSGDLAVLYTDGITEAMNSQRQFYGIERLQTVLCQHRHQA
PAEIRHQAIADLRNFLGDQPAEDDVTLLILKQK
Download sequence
Identical sequences P74554
1148.sll1365 gi|383323864|ref|YP_005384718.1| gi|16332121|ref|NP_442849.1| gi|16332121|ref|NP_442849.1| gi|383327033|ref|YP_005387887.1| gi|383492917|ref|YP_005410594.1| WP_010874143.1.11876 WP_010874143.1.1889 WP_010874143.1.18904 WP_010874143.1.33690 WP_010874143.1.35395 WP_010874143.1.47586 WP_010874143.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]