SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332241|ref|NP_442969.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332241|ref|NP_442969.1|
Domain Number 1 Region: 337-528
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.61e-50
Family Ppx associated domain 0.0022
Further Details:      
 
Domain Number 2 Region: 143-323
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.41e-42
Family Ppx/GppA phosphatase 0.00071
Further Details:      
 
Domain Number 3 Region: 14-137
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.37e-36
Family Ppx/GppA phosphatase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16332241|ref|NP_442969.1|
Sequence length 540
Comment exopolyphosphatase [Synechocystis sp. PCC 6803]
Sequence
MAPSSAQIVDPCMLAAIDIGTNSVHMVIVRIDPVLATFTIVAREKDTVRLGDRDPQSNNL
TPAAMNRAIAALKRCVELAKGLEVENIIAVATSATREAKNGQDFLTRVQTEVGLTVDLIS
GPEEARRIYLGVFSCMDFHEVPHVMIDIGGGSTELILADRRDVRFLSSTKVGAVRLTQDF
VHSDPIDATELAVLRAYVRGMLERPVDEIKQRLKGGEKAQMVGTSGTIETLATMTALQKQ
KEVPNPIQGYSISQKDVEEWVKKLAGLNCQERFEVAGLSDRRAEIILPGAVILLEAMTML
ELDSITICERALREGMIVDWMLTHGLIQDRMRFQGEIRQRGVLKIARKYQVDLGFGERVA
QFATSFFDQLRGVLHDWGETEREWLWAAAILHNCGTYVSHSAHHKHSYYLIRNAELLGYT
EIELELIANIARYHRRSKPKKRHDDYIKLSEPHRLAVRQLSSLLRLAVALDRRQVGAIES
FDCRYDQDKRQLHLHITPKDPDDDCALELWNLDYKKVVFEEEFNTKVVATLAILLKSRQG
Download sequence
Identical sequences L8AL38 P74663
gi|383327151|ref|YP_005388005.1| gi|383493035|ref|YP_005410712.1| gi|16332241|ref|NP_442969.1| WP_010874262.1.11876 WP_010874262.1.1889 WP_010874262.1.18904 WP_010874262.1.33690 WP_010874262.1.35395 WP_010874262.1.47586 WP_010874262.1.99424 gi|383323982|ref|YP_005384836.1| 1148.sll1546 gi|16332241|ref|NP_442969.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]