SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|16332268|ref|NP_442996.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16332268|ref|NP_442996.1|
Domain Number 1 Region: 35-400
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.13e-75
Family Pyruvate oxidase and decarboxylase PP module 0.04
Further Details:      
 
Domain Number 2 Region: 408-620
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.06e-20
Family TK-like Pyr module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16332268|ref|NP_442996.1|
Sequence length 821
Comment phosphoketolase [Synechocystis sp. PCC 6803]
Sequence
MGSTLVGKCTSLGVFSMVTSPFSLSPFGQARSTVTGNPLDPTELNQMHGFWRAANYLAVG
MIYLRDNPLLREPLQPEQIKHRLLGHWGSSPGISFLYTHLNRIIRKFDQDMLYMVGPGHG
APGFLGPCYLEGSYSRFFAECSEDEDGMKRFFKQFSFPGGIGSHCTPETPGSIHEGGELG
YCLSHAYGAAFDNPNLIVVGLAGDGESETGPLATSWHSNKFINPIRDGAVLPVLHLNGYK
INNPSVLSRISHEELKALFEGYGYTPYFVEGSDPESMHQAMAATLDHCVSEIHQIQQEAR
STGIAVRPRWPMVVMRTPKGWTGPDYVDGHKVEGFWRSHQVPMGGMHENPAHLQQLEAWM
RSYKPEELFDEQGTLKPGFKAIAPEGDKRLGSTPYANGGLLRRGLKMPDFRQYGIDVDQP
GTIEAPNTAPLGVFLRDVMANNMTNFRLFGPDENSSNKLHAVYEVSKKFWIAEYLEEDQD
GGELSPDGRVMEMLSEHTLEGWLEAYLLTGRHGFFATYESFAHVITSMVNQHAKWLDICR
HLNWRADISSLNILMTSTVWRQDHNGFTHQDPGFLDVILNKSPDVVRIYLPPDVNSLLSV
ADHCLQSKNYINIIVCDKQAHLQYQDMTSAIRNCTKGVDIWEWASNDAGTEPDVVMAAAG
DIPTKEALAATAMLRQFFPNLRIRFVSVIDLLKLQPESEHPHGLSDRDFDSLFTTDKPII
FNFHAYPWLIHRLTYRRTNHGNLHVRGYKEKGNINTPMDLAIQNQIDRFSLAIDVIDRLP
QLRVAGAHIKEMLKDMQIDCTNYAYEHGIDMPEIVNWRWPL
Download sequence
Identical sequences 1148.slr0453 gi|16332268|ref|NP_442996.1| gi|383324009|ref|YP_005384863.1| gi|383493062|ref|YP_005410739.1| gi|16332268|ref|NP_442996.1| gi|383327178|ref|YP_005388032.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]