SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|38505540|ref|NP_942161.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505540|ref|NP_942161.1|
Domain Number 1 Region: 1776-1903,2041-2358
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.92e-32
Family Integrin alpha N-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 2738-3007
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.8e-27
Family Integrin alpha N-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 3248-3317
Classification Level Classification E-value
Superfamily CalX-like 3.01e-17
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 4 Region: 1376-1467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.05e-16
Family Laminin G-like module 0.056
Further Details:      
 
Domain Number 5 Region: 2962-3157
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000576
Family Serralysin-like metalloprotease, C-terminal domain 0.0048
Further Details:      
 
Weak hits

Sequence:  gi|38505540|ref|NP_942161.1|
Domain Number - Region: 1045-1152
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000973
Family Clostridium neurotoxins, the second last domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505540|ref|NP_942161.1|
Sequence length 3797
Comment hypothetical protein slr5005 [Synechocystis sp. PCC 6803]
Sequence
MANPYASYAAPVVDAAGTKHLVWEDNGRLYHAHYDSRAGAWVDKNTVSNAQGGSDIKLLA
GNIIPVDQSGKLYAPGLVAAWIQGIGNAAEIYVSVGRYTDDGRLEWSDAVQVSKDAVANT
SFDLGIGQDGLIQVVTQKVLKIADPRKSDYQNNPGQLAEDIKSPQQGDKDLYYSTLLIEL
ERKTGSLFLVPNPEVNASGTTDIPDDADALNFNPDFYVAKTNRTGSLSQILLNAPPSNSP
SLQQSGFQSAGLLSASSPTPGNGFLSNTDSDSQNDISLPATGGPAWGFDITIGTTQHTTE
GTTFPLPVLEEANKFASLFGVELGINLSGAIKTKVSRDSDDVYSVDADLALSVDLVKEQT
RWKAFGRNQKLDPRIDDPVNGGLMPDPNNPAYNASIDTNQGFSGIQFSLNFSGSQSSNAN
GELQSLENFYGLKVAFPKRVTFNIPSIPGLEGALARLQALIQFSLAIGYQGIGSDPGPNA
EAPFTLKPDTKPNLYDGLSGAGGGGAGFFQAITWLTAYNNYKKGTPGLGAGGKIFAGVNT
AFSLLAASDILAASGPLIFPGEFDDFNTTQRGLLIEILATGGLSGSILAGLLGAEGTIST
GFDFEFLSGPQPFIFKIPYELSIEARAAVLTFSWDISGDIVDTTDSSAQTTSIGLLSDDA
SHNDQNSEMVRLKLAYSPYQGSTAIHENGRFSTVSPTTRIAQPQLLTAFPSTASQNNYVI
GSVSVEEGGSGYLGGESGNFLVVPSIGNALLMAYVEKGVIQQIVVESPGIGYDRNNPPTL
DFSQYGGGGSGAKAKVNLIDREVLDLTNDGRPFVDSVVFFAGPSAQAETALIWIADGADS
TKPISDSANQLTTRVQVSELAGTNWSIPTALPLQGSEGMNYDPVIAKFISRDNRSSLLAV
WAHARADGIGSHSVDDLTNTLDSILETDIYYSVRIGNGTWSNPEKLITLEGTDNRLDIGR
LNDGRLHLAWVNAEANATEGGIQRIYSAFFDPTEETWSTPVAIDPTKDIDTPNRSEISSL
KVGQLEGEPAMYWSNTAETPYVVSVLNDSPELYFRLESSAINQSEINYGNLGNSIVSNLS
FYDGNMTFGQEGALSQDPDPAVRFNGQGAFVIGIPDKQTVTPTSFSVETWVKLTDTAAGK
GIVTRGQPITIPATLPTATLTYKVTQGQDTDGKWFYLITPDSVDLGNSGQDIFPNTLRVT
NFRANEQLDIPFNPIESFALRAEPDDFLGLDFIGTDDVYIIRNTPQDVVIGDGTLIVRRF
DPGTDKNREERIELSAGQKIQIGGQIYTITAGETFTVSLKAGDNISIFDANPPGTISQSL
APNFNFTPDESGSLSGIQVNSNQILSSGTGFSNRPFVNEAESFTLTAELEFEQIEDWYLV
TGNNGSIVFNSGAGEISSESLDQGQWHHVVATHNSTTKESILYINGQEVAKTIGERFAPS
DNPILVGYNLNGFLDEVAIYNKPLTVADPNAVEFDSTGKYVVAFNPNAPAGEITSHFNAR
DVDPDSAEEATYYSVWNGERWGTPEQFAAEYKLTPTQASLSRTPAVDMVGSNGLQPDGVL
DQHLQVTLALPNEFLFGRTITGIEIKDAQGNTWSINNNIESPLGSNLVGAMLAGQRVNDL
KNGAFEHTVMGVKEVLDLYFDDPNVQSDKTYSVTFTMKDGGTIPPLDNLAPSPNIQGSSS
KSSIVKAEILEKEVTSLAEVDSGVIIDIDTVGAGQSLAAGKIRNGEIGFAIGHPYQIDED
LNKRGLVWVLPAGTNKKLNELTGIPLKNDDVPAEGALIIGKNGDKIGYAMAVGDIDGDGI
DDLIIGAPDADDKKGKIYVISGKYLGSGHTINLASLPDNAVVTIEGTRLSNAGFSLAAGD
VNGNQFDDIVIGAPNALNSEGKAVGAVHLIYGSADFFSGNKTIVLGTNNLLFEGKRGTAK
SKFELFPNPANQWHSQVGYSVAIVRPGATGNPNAHSFNADLVADILIGAPGYHQTVQFDR
QGFPQGISAEQLGRYRSVLNHVPNFGTDSVAPERDLNTGRAYLIFGGDNLTVNGPLNDEN
LSGKGVIFDGSPLEDGDMRLGEVVTSAGDMNGDGYIDISMAAPEAAGRSGLVFIFGGRGG
SDSIRLKDKYSVMTESDVLIAGGDVFNYAGQSLGGVGDVNNDKIDDLLVGVPQAGGAKGQ
NYVIFGVENFEIGKGNFPTTISLKQGIPDDSFVFNGGIAQGLAGYAVAKGFDLNGDTVGD
MLLSAPFANQVYVGFGHPWLKKEGSVRLDNLANDNGIIINRYEGSEPKYSFDGRRVTNLG
DINGDGYADTGVAGNGDSILIQFGGPTWDLIDAGFGVGQLSVFLRKDVITDINFESIEGV
GDINNDGFDDFIIYNSRSKTKEVHDFTIVYGGDYLNSLGSATIDVVVAPGEEIRQRERLA
NPGFVLSNSATDLKLYHSSLGLGESIYAPGVGFNGKQSRLTLEENGELIFYLHGTPQKIG
GQANAGIVKMEIGVLDGKDRLLFKDKSDKIVTYSEEHYNQTEEQITYLRVGDDFVMLSNR
FNYAVPGRNDIKIFGYDFDQSVNVVQQHYPSSVWGSVLPSLLAGESITAPDGQRSFMVMP
LNYNLKAEDGQRVVAGIVDKEFNVISSLISTRRVPMITSDLEFRSARDAYLILGNDTVVT
PSSGGDFTHTKGSLLFVYNGFYYDGNALRNILGGASRTGRDYEIEWTSETQGQDLLFHLD
SNIKNINLAQKGTAFDGSQGTLQYKNFHGSKLEEKLFEFLPVGDLNGDGYGDIVAFDSEF
TYIYLGNASGKISTLPSSNYSGDEGMVFSSRWAVGSGIGDINGDGYDDLLSQSKDGIFIV
FGGPILSSAQRISISNFLTIDSQFSQSPSTYEAGDVNGDGFADFIVRDSHVVAGSTRGAL
RLVYGNATGKNFQSTQIQTYLPVYYPLPVTRAGDVNGDGYDDIIFSDPSYLDNNAGRVYI
LFGGSHLTNKATITPEEINSLEGKDGFVIDGLASSDSYSRAGESVSGGGDMNGDGFKDFI
IGAPGTDGTVGLTYGLFGGDFTKSVNQAGTLANDILEGTGTGDVIIGLAGDDTLMGNGGR
DVLYGGAGDDTIIIADTYFQRIDGGSGFNNLKLEGYRGQDWDLTPLSPGLRLQNISAIDM
TNYGSNTLTLNKTTVMKMTGTQNNLVILGDANDEIILDAEFRKVDSFNLFGTLFDRYQAG
TANVLVAPNIKTEVKFTANRINQTIGLSNATPVTNSRLLSAASPNRITTIIPASNGQPTQ
FFVVANPTREDAGVFTFTVNRSGDLSKSVTALYQTVNDTAIAGRDYTAILGTLVFAPGEI
SKVIEVPLLDNNEYGGNNRSFGLAIQAIDDIFGERYGSNFLQLSTDNGNQIRNLDSGSLA
PEVVKQLGAALPFGAMGFSVTAPEGSASVTMPFQGITELNSYFRFNQISGQYEEFLYNGE
SGVEFLDTTNDGRADTLKIHLLDQGRGDGDGLGNGVITGLNVPAIVNPGLVQVNPGVFLA
PTNGDGVLQLRLITNQQESNQIGWVMVDDANGSIDGLLPDAPGYLEAALARKQVVFENAY
SASGQAFDRASAQQSFTELNALIQTESQFFGSLQSLELGGGGYYIFYNESSSQTVFSVNT
PVTVETESRGYHQISFDGLTMEIASKALVVPGNLDDLVVGQISIGRAGAYENQILLYQVD
SLSGGIDTDGDRQINLRPGDTGYVEAALKRAQNPATGASFNAPEGFFSTGQETVNLRGGS
MYGMAIIPNATIGEVLSLNPNNNPELGPVALFSFDGANPAGISQMSRLGSNLFGFEDMVG
GGDADYNDVILEFSHQF
Download sequence
Identical sequences Q6ZEX5
gi|38505540|ref|NP_942161.1| gi|38505540|ref|NP_942161.1|NC_005229 gi|451816548|ref|YP_007459751.1|NC_020296 gi|38505540|ref|NP_942161.1| WP_011153542.1.1889 WP_011153542.1.35395 1148.slr5005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]