SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38505621|ref|NP_942242.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505621|ref|NP_942242.1|
Domain Number 1 Region: 102-473
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.58e-92
Family AAT-like 0.0000363
Further Details:      
 
Domain Number 2 Region: 3-74
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.2e-22
Family GntR-like transcriptional regulators 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|38505621|ref|NP_942242.1|
Sequence length 476
Comment GntR family transcriptional regulatory protein [Synechocystis sp. PCC 6803]
Sequence
MTTSPNQTLYQTVADQIHGLISEGTFQPGDRLPSVRKLHQQWSVSISTVLEAYRLLEDRG
LIEARPQSGYFVKTILNFLPDEPSPSTPQSADNPVDTSLAFRVNNSMLKPGIIGLGAAIA
GSNLLPIATLNRLMGQVIRAKPEVTHRYSSPQGCEELRHEVARRLIDTGCSITPDQIVIT
NGTTEALYLSLKAVTKPGDTVVIESPTYHLLLETLEALHLRILELPTHPQHGISLIHLED
ALKNDQISACVLIANFSNPLGSCMSDSKKKQLIGLINHYNVPLIEDDIYGDLNFTGNRPK
SIKSFDTQGLVLYCSSISKTLSPGLRIGWAVPGRYQTKVEQLKMTTNYMTAVAPQLTIAA
FLANGGYDRHLRKLRRTYQAQMMDMTQAICNYFPKMTRVSRPKGGYILWIEMPEIVDTLQ
LYEDALRHNIAIAPGSMFSSSGGYRNCFRLNFGLPFTEEIQQAMIVLGQLLHEQTK
Download sequence
Identical sequences Q6ZEP4
1148.sll5086 gi|38505621|ref|NP_942242.1| gi|38505621|ref|NP_942242.1| gi|38505621|ref|NP_942242.1|NC_005229 gi|451816629|ref|YP_007459832.1|NC_020296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]