SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38505745|ref|NP_942365.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505745|ref|NP_942365.1|
Domain Number 1 Region: 5-186
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.46e-37
Family HD domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|38505745|ref|NP_942365.1|
Sequence length 193
Comment hypothetical protein sll7077 [Synechocystis sp. PCC 6803]
Sequence
MNLSHPTPLTPRFGDALVLANQLHAQQFRKGSPVPYISHLLGVTALVLEMGGNEDEAIAA
LLHDAVEDQGGEATLNVIREKFGETVAQLVLGCSDSSTVPKPPWEERKQQHLQKMSRISL
AVLKISLADTLHNARTIEIDLHRYGNDIWQKFSRSKSGIIWYYQSLWQIYQDRNPNPWSN
ELIDIINGWAYGK
Download sequence
Identical sequences Q6ZEC1
1148.sll7077 gi|38505745|ref|NP_942365.1|NC_005230 gi|451816748|ref|YP_007453015.1|NC_020287 WP_011153746.1.1889 WP_011153746.1.35395 gi|38505745|ref|NP_942365.1| gi|38505745|ref|NP_942365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]