SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|38505826|ref|NP_942444.1| from Synechocystis sp. PCC 6803

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|38505826|ref|NP_942444.1|
Domain Number 1 Region: 542-713
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-35
Family Histidine kinase 0.003
Further Details:      
 
Domain Number 2 Region: 736-853
Classification Level Classification E-value
Superfamily CheY-like 9.39e-27
Family CheY-related 0.0053
Further Details:      
 
Domain Number 3 Region: 361-471
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.07e-21
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.09
Further Details:      
 
Domain Number 4 Region: 93-219
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000262
Family Flavin-binding PAS domain 0.081
Further Details:      
 
Domain Number 5 Region: 242-352
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000075
Family Heme-binding PAS domain 0.082
Further Details:      
 
Domain Number 6 Region: 475-548
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000129
Family Homodimeric domain of signal transducing histidine kinase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|38505826|ref|NP_942444.1|
Sequence length 862
Comment two-component hybrid sensor and regulator [Synechocystis sp. PCC 6803]
Sequence
MSASLQRVMSLKTADIMGIQRYPIRLSNSTFEEKFWSPVNSPVLDEFGAVEFIMHRVEDV
TAIVHENSFAVLTEITKTENRIALQDIILRSRELKQTLSKLQEHEARIRTAERMLSLGTW
EYNPQTGTLNWSRHVFDIYGIPPTQKALDVEEYFAMVHPDDREASIAVYQSFMEENAPRI
AFEHRVITRNGGVRCVKGVGERHWTPDGEIVVGCVQDITSFIRNRDKLTQAEYLLRLAGE
KASLGGWRIELDPPVITWTSETAVIHGMPPDYSPPDVGTAVQFYAPEFREFIMEVFERCV
QQGEPFDVICQLQVPDGRRPWIRAIGEAERDAQGKVIVVQGAFQDISTLREAQERFQLIS
KAANDVIWDWNFATNQVWWNDSITDLFGYALLDMEPGLESWTLRIHPDDKERVLHSIYQV
IDGEENYWECDYRFMKSDGQYANVIDRGFVTRDGQGKATRMVGSMLDITERMAMEQRLRE
SQKMEAVGHLTGGVAHDFNNLLTVILGNAEMLAELVTDPDLQSMAEMTLSAAKRGAELTR
HLLAFARRQPLDPKPKNINHLVEAMWGLIRRTLPENIELEFAPDPDLGIAEVDANELETA
LLNLVVNARDAMQDGGKLIIETSSAVLDNDYAALHCEVIPGDYVMICVSDTGIGMSADTV
SHAFEPFFTTKPVGKGSGLGLSMVFGFTKQSGGHIKIYSELGEGTSIKLYFPKVKDAQRI
NYQPAKELIPKSGTEHILVVEDDDLVLRHLEGQLRSLGYRVTAVTCGPNAIEALKAHSDI
DLLLTDIIMPGGMNGRELADLAKATYSKLKVLFTSGYTENAIIHHGRLDPGVDLLSKPYN
RLELATKVRRVLDKDLNPITSY
Download sequence
Identical sequences Q6YS03
gi|38505826|ref|NP_942444.1| gi|38505826|ref|NP_942444.1| gi|38505826|ref|NP_942444.1|NC_005232 gi|451816789|ref|YP_007459877.1|NC_020297 1148.slr6001 WP_011153820.1.1889 WP_011153820.1.35395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]