SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18309764|ref|NP_561698.1| from Clostridium perfringens str. 13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18309764|ref|NP_561698.1|
Domain Number 1 Region: 3-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.59e-61
Family Glutathione peroxidase-like 0.00000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18309764|ref|NP_561698.1|
Sequence length 189
Comment alkyl hydroperoxide reductase [Clostridium perfringens str. 13]
Sequence
MQMSLINKKVLDFKVQAYQNGEFKEVTSEDLKGHWSVFVFYPADFTFVCPTELGELADNY
ESFKEIGCEVYSISTDTHFVHKAWADASDTIGKIKYPMLADPTGKLARDFEVMIEEEGLA
LRGSFVINPEGEIKAYEIHDNGIGRNAEELLRKVQAAQFVAEHGDQVCPAKWKPGEETLA
PSLDLIGKL
Download sequence
Identical sequences Q8XMA8
gi|18309764|ref|NP_561698.1| 195102.CPE0782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]