SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gb|cgd1_1950 from Cryptosporidium parvum Iowa II

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gb|cgd1_1950
Domain Number 1 Region: 362-407
Classification Level Classification E-value
Superfamily RING/U-box 1.36e-17
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 2 Region: 200-276
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 6.54e-17
Family Cdc48 domain 2-like 0.00061
Further Details:      
 
Weak hits

Sequence:  gb|cgd1_1950
Domain Number - Region: 142-194
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.00458
Family Cdc48 domain 2-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gb|cgd1_1950
Sequence length 413
Comment | organism=Cryptosporidium_parvum | product=hypothetical protein | location=CM000429:454724-455965(-) | length=413
Sequence
MDSGEQLKNVLSRIQLLPWKEQHDIELLLKVLRKYEVENRVLKPFDKVYIDERNYFVVLF
CDPVEGGALSESTQVFANGKPLMSLQKVHFLALPPFNAALSPLAQKVSTIRLNRLLQDQR
EFEREIEVSNSEVENLCGSDQLCRLYIEPYFQKKRKEPIYVGRKVEIDGITFLVWACEPT
QVGVIDGNTAVYINWDCFGEFKRIHVMPFSDTLPQTYSFDIFQDYLKPFLSRYTFHPFSE
GESFTYNGVQFKIIATDPAGVKARIGDNTTIYCQGSLTPSIVDLLPVHLLENIIRLPPRS
RPFSILQALAHLPPSDVDRIFGSADSNNSRGINNEIVNKITQKSYYYGEGNETCSSSDDA
PLCTVCLSEVNEGDFVVRLDCQHIFHHQCIKEWFKMSVICPLCKVDVRGSNNN
Download sequence
Identical sequences A3FQD6 F0X3T4
gi|126117235|gb|EAZ51335.1| gi|126643972|ref|XP_001388158.1| 5807.cgd1_1950 XP_001388158.1.25317 gb|cgd1_1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]