SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00264 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00264
Domain Number 1 Region: 412-752
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.15e-63
Family beta-Lactamase/D-ala carboxypeptidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00264   Protein: CBP30984   Gene: WBGene00023689
Sequence length 806
Comment CBP30984 WBGene00023689 locus:Cbr-lact-7 status:Predicted UniProt:A8WMK9
Sequence
MRLLHLSLSPTIGVLVLAFITIQVTEPCTGEQLDLNAHFHGFTTGKRINAYPYTAPERVV
DKALAKKHRKPQQAAQPYEPPNGAAASPVDTSADFGMQNGMQGGGPGMPGMMSNNRLPPL
QTVHPPAPNEKAWVLTAGNESLVDNVLAISLQYGGRLVSMGYYLRGQDVNYYAIMHKYSG
PVFIKPAPMTFDELIKAVRENEARDLALTQVCGQEGKPGEITFTTYWERVPGVEFHIWFP
GQPHADEQKTHFENNGYRLTYLCGYTEAGKGKYVGVWQKPVKSEAQYEAHYGLTMEACMQ
KDRILVQKGFVATSLRVFNNKNQVLCTGIWENRNGRSSIQVGQNLETMYRNMQRNPNMIP
RQMSHYTDNYQNVVYVVLWSDVDVNRYPNPPPLWDETPIPVRFLKGSPELLSDNQMEFLI
KRVEHFMKDLNIPGLSIAIAKKEQLKFAAGFGYTDIRQQEPVTPNHQFRVGSVSKPVTAA
AIMLLIDKGHFTLDSKLFGKDSIFGSEFSKKYQYPRYVTEITVRNLLEHTSGGWDNLQSD
AAWVQPDMTTKELIEHVLTNVPLEYKPGSMWIYSNFGYQLLGYLIETTTGMSYEAFVKKN
IFAPSGVYDIQVARPSISERAPREVVYYMSGNGLGFNPYEMLPPERIGPWGGWIASPIQL
LMFMSRIDGFHNREDILSEYSIAELSTPSPASNDTYGLGWSLNIMGFNGWQHDGRMPGSA
AMLVRLDNGLEMAVTVNKEYSERDFFHELGYVLHHIGNNCDWWNDDYDLFQKSRRSSRSA
KRHLYPLATQRTTVHSTTNPHIIRFA
Download sequence
Identical sequences A8WMK9
CBG00264 6238.CBG00264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]