SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00413 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00413
Domain Number 1 Region: 42-424
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.1e-54
Family beta-Lactamase/D-ala carboxypeptidase 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00413   Protein: CBP31427   Gene: WBGene00023804
Sequence length 438
Comment CBP31427 WBGene00023804 locus:Cbr-lact-6 status:Predicted UniProt:A8WN12
Sequence
MRLDFDTLGCLYLFAIPFVVQPFLSCWLTPYVNDDDVSGYVDERFQSVLEAFRRNFGQGE
ERDGAAFAVYYKGQEVVNLWGGYADKESQRKWKEDTKTVMFSASKAISSIVIAIMVDRGY
LNYDDRIIEYWPEYGKYGKNGTTVEDVLSHKAGLPYLSDTVSIEDVKNGWKIMEKVENSV
PAWTPGTASGYHAVTFGFILDGLVRKADPQGRDIKAFFEEEIAQPYDLDIQIGAKKSEAP
YLTRLTMPSLWEFTRDIIKDPKILIMLGLMYVRFDTLVDKMRSNPDWLLVNYDTMVLNDP
EIVSLNLPAVTAVANVRDVSRLLSMIVEKEIISNTTLLEISEPTLNSWHLEKVTIWPVIK
GHGFFYEKHPLVPGAFTFGHPGYGGQFVHMDTESQISITYLSNGLKTGTGELCGTYMRLF
NEVYNSVRRIEEDNGSLL
Download sequence
Identical sequences A8WN12
6238.CBG00413 CBG00413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]