SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG00964 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG00964
Domain Number 1 Region: 357-494
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 4.97e-18
Family Mannose 6-phosphate receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 212-273
Classification Level Classification E-value
Superfamily EF-hand 0.0000000461
Family Parvalbumin 0.063
Further Details:      
 
Domain Number 3 Region: 38-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  CBG00964
Domain Number - Region: 77-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00249
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG00964   Protein: CBP00271   Gene: WBGene00024267
Sequence length 506
Comment CBP00271 WBGene00024267 status:Predicted UniProt:A8WP81
Sequence
MLLQLLVLLVPAALGEDVTQRQLKPVKGVPHSRLHLYQSSTTDTFRCLDGSQTILYSQLN
DDYCDCKDGSDEPGTSACGNAFFYCSNVGHKGNFIPTNRVNDKLCDCCDGSDEYDSGVEC
PNICDELGRAARIEREKIASVARKGFQKRQELAKEGQALRDSKLKDVEPLRQERANIEPE
RARLETEKKAVEEVEKKLQDEHRNQWEAVRIEKKKLRATDWFDELDLDKSGKIDREELRQ
NLFLDNDHDGFVSEDEVKSYLTIDEADFEHFQSSMYDRLKEARHQHREEMKYKEEQEKEK
AKALENAPDDDDLLAEEDRHEEEEEDPEDVRAQEDDKMPAYPPEINEASEKAREARRLFD
EVNEKVQDLDAKIREAEDFTNSDYGENYEWAALKDKCFDRNVQQYTYQFCPFGQNTQKDV
GAYGGTSLGNFKNWSGGETNKYSKMHFGDGQQCWNGPKRSTDISIECGEENELVEVTEPA
KCEYLFTFRTPLACTDPDKEIVHDEF
Download sequence
Identical sequences A8WP81
6238.CBG00964 CBG00964 XP_002629732.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]