SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG01082 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG01082
Domain Number 1 Region: 560-762
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-39
Family SPRY domain 0.0094
Further Details:      
 
Domain Number 2 Region: 493-593
Classification Level Classification E-value
Superfamily Fibronectin type III 3.17e-16
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 3 Region: 266-329
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.0024
Further Details:      
 
Domain Number 4 Region: 2-39
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000306
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Weak hits

Sequence:  CBG01082
Domain Number - Region: 319-398
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0131
Family Apolipoprotein A-I 0.016
Further Details:      
 
Domain Number - Region: 199-234
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0485
Family B-box zinc-binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG01082   Protein: CBP31560   Gene: WBGene00024366
Sequence length 768
Comment CBP31560 WBGene00024366 locus:Cbr-madd-2 status:Partially_confirmed UniProt:A8WPI5
Sequence
MEEELKCTICTRFFDDPIILTCGHSLCRMCALKAHQPSTSSATSSMSSPRPSTPGILSQI
LSSASSPISPQSAGSSSGASDTMSLCVSDGGDHESDKLSVVSETDSGVVGCGRTSRPSSI
IGPPLSRLHNILTPSTSGVQLICNSCQKPSYYCDENSIVSAPTNLAMQNVIKRYLIAHPN
IKAGPSVCTPTEETPCSSTVPQCQLCEGTDNRQANVFCEQCDIYYCSPCQTALHPARGPL
AKHNLIEAGGRKKSSTSTLPLNNATTTARDLLRCVTHPGEGLTMYCLACKVPVCSRCLQD
LRHANHDVQSLPIACKGHKTELSTTLQQLSEKAKTATEEIGRLKGLHDVIRNNCNDFKSN
VCIQIDQLIEQLQMRKEKLMQHVEEQAENKRRILKAQIVRCTGKLTKTSALIQFCIEALK
EPDATVYMQISNALLHRSTSLEFLWHKEMRTKPEIDSDFVLNLDTKHLQYTIQTLDFAQL
KAGCRGTRFKGDPSRVPSAPIIETSECSAENNSVTVVWRPRNDGSAVDGFALEIDTGRDD
GNFKEVYSGPDTICTIDGLHFNTVYTARVKSFNSAGESEYSESICLQTAQVAWFQLTKSP
SQRDMILSNECATLCGNTLEHRTVLGSIAFSKGVHYWEVTVDRHDGHADIVIGVAQPAVN
RNLMLGKDLHGWSMYVDGERSWYLHNETHHNRILGGVGRGTVIGVKLDCDRGVMEFTIND
RKRMYQGNPVAFTNMPRGLYYPAFSVNANAAITVHTGLSCPPSPDGSE
Download sequence
Identical sequences A8WPI5
CBG01082 6238.CBG01082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]