SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG01538 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG01538
Domain Number 1 Region: 1016-1164
Classification Level Classification E-value
Superfamily Fibronectin type III 6.68e-23
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 406-501
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000038
Family I set domains 0.0086
Further Details:      
 
Domain Number 3 Region: 95-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000153
Family I set domains 0.0073
Further Details:      
 
Domain Number 4 Region: 515-625
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000153
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 901-984
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000383
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 6 Region: 822-923
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000497
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 7 Region: 612-699
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000659
Family I set domains 0.014
Further Details:      
 
Domain Number 8 Region: 1177-1277
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000149
Family Fibronectin type III 0.0047
Further Details:      
 
Domain Number 9 Region: 282-360
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000497
Family I set domains 0.026
Further Details:      
 
Domain Number 10 Region: 178-260
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000188
Family I set domains 0.035
Further Details:      
 
Domain Number 11 Region: 703-823
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000562
Family Fibronectin type III 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG01538   Protein: CBP34960   Gene: WBGene00024762
Sequence length 1402
Comment CBP34960 WBGene00024762 locus:Cbr-sax-7 status:Predicted UniProt:A8WRF3
Sequence
MVTSSVSGRLSRSRTKFRRDSRSRRQTPTSEMRSFVLLILLTSHLSAGSIDWSSLETPPQ
FTHGKNAETVFFKVEKSGMSDESAKNIPGNLLEQTIHCQAIGNPRPTYRWKKDGKTFLPS
MFPEKVVQKPGEGSLVFSRLDETDAGLYQCEAENSNGTAVDRPVRVQETWIRHFKAAEPE
VVVVEVGDPYQRNCSPPASNPNARVYWILMGKEPGHFETISSSHISSNEQGTLFFHYVNE
TDLKSDRYYTCTAENIELKDYKFGNQFSLQITNYKRRSLQQMPPTEQYVNQSSPIALQGN
QHKLHCFFSGYPAPKPRWYHNGKQINEDGDSDGFRFESYGKTLVFNVTQDKAGKYDCRFA
MQNDIDRTFNVVVEGESFFPVSNNSNDWEDDKKIVIKFCKKPNFPAPYWPNGPPPNTNTS
EGENVSFDCTTYGKPTPKVTFYKNGVELGSQKDDRYMIEGTRLTIYDVKKGTYGKGDNAV
YQCKSENKHGWLWTNFYLNLLAFKPQLLIDPGKEEVEAVIGKKVTLECKFFASPNAAVKW
EAPMISGSKGNQIPADPHGVGRLVFSEVSASEEGEYECIGTNKYGQASGVITLKVRKPTT
VKPFDRAEDVRMAGEEMRLPCDATSDSQLEVKHEWLVDGIPLPEERVNSGHYRIADDHSL
IVANPTQDDSAKYKCVVSTKLDKVEKEIKIQFKGNPNIPFSHIFFTLSDVPVAVHSAYVS
NCDKNSLTAFIKFDHIESIHTIAPVKEFWVQYQMDSETEGSQWRTHPSPSAAHPNDQVTD
QLRTTSGSATVSLQPFGKYVFRVLARNSVGDSATTTVKGICETPAKQPDKNPGEVAAKGT
SPENLIVQWKPMAREEWNGAKFHYVVKYRPVDEDQRDGDWKEVAVEDPFADRVTINLDDD
KDVKPFQPYEVQVQAVNSEGRTNVVPETVEGRTGEGVPSSIPSGLRVLEKSGTTVTLAWN
GVDPATANGNFTGYKITYWVDEADQDVEEPEDDEEEKRKFRWKRSIRAKRQSGVRKTIVF
GPSATQGTITDLKPATLNHAYIQVTNGAHEGPSSDTIDFQTDEGVPSPVRSLRAYPMNSK
ESDEKGVVVLVWKKPRQTNGKLARYEVEYCKTQNGKQVEKTCPRQQIDADAKEIRITGLE
NETPYRFILRAHTSAGEGDPNSSDATTLPETTAAGVDPGVPSLVENAIGDKYFNVSFRPA
KYDDETRAPVGNTYEVQYKPQNGDEWETVKPSDDGLTVHVDGLSPGTKYDVRVAALQVDS
DGGETTKTFSGISKITTTGTSPGERNLYFIILILLILLLLLIIICICCVVCRHRGQNYPV
SQREREQGREPILGKPDYKTDDDEKRSLTGSKAESETDSMAQYGDTDPGVFTEDGSFIGQ
YVPQKSLMPAERPEKGSTSTFV
Download sequence
Identical sequences H8WH61
CBG01538 6238.CBG01538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]