SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG01571 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG01571
Domain Number 1 Region: 659-918
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.91e-72
Family Eukaryotic proteases 0.00024
Further Details:      
 
Domain Number 2 Region: 183-290
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000773
Family Kringle modules 0.0035
Further Details:      
 
Domain Number 3 Region: 75-197
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000748
Family C-type lectin domain 0.0072
Further Details:      
 
Domain Number 4 Region: 566-653
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000131
Family Scavenger receptor cysteine-rich (SRCR) domain 0.021
Further Details:      
 
Domain Number 5 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 532-573
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000694
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 328-397
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000126
Family Hairpin loop containing domain 0.039
Further Details:      
 
Weak hits

Sequence:  CBG01571
Domain Number - Region: 428-462
Classification Level Classification E-value
Superfamily SRCR-like 0.00955
Family Scavenger receptor cysteine-rich (SRCR) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG01571   Protein: CBP26822   Gene: WBGene00024790
Sequence length 921
Comment CBP26822 WBGene00024790 locus:Cbr-try-2 status:Predicted UniProt:A8WRC5
Sequence
MESSRIFDDLLEVRSQTGFFFPLCSKSFHQKYGEQACASISNTFSSYSEIPLQQYTYSIG
CTSSICFTFLSAFCKTGIKVFCSSSLCAPGTLQVGNKCLSISTVPVQGYSEAKDYCSPYS
LISSLKPSEIESIRETILPSFTDTRSFLTSGLRQGSTWKWGNGDTVEQEISGTGRCLAFQ
SGVLVAFDCDTEAYVFCESGRECVGRNTEYSGTSNRTSDGQGCLMWNDPAVLFQRDSDFE
IWNHNFCRFIEQDGRKSPTPVCYSKPHQLSECNIPNCPESLNDAIVLETGDSCPIGSFSC
DNGSKCISEKFQCDYEVDCNDGSDEQNCEDYLQNYELIGAYRLADSIIEVWTFIPHVQGC
ARKCRESLLMCEAFSYEPKTQTCLLTDTSQTYSSLARKITSLYYRRRFSSKDVTFEVEED
TVMYATKNSKKGQVCNENFSREKLSSICKILGFGDPIYIVESHPTELFLERESLPQSSAD
SSSSRLSSSLYSGRPVAALRLPTWNLSCLREPNCTSTIVSTCQPSSECSRCQEAACGDGS
CIRSRQLCDGSIDCKSGDDESDCTARSFRLTNGSDTRGYLEVLFRAKWEPLCADHLDGNR
ANLICNDMRLGEHGSLLSTNISISSGFDVICGSECILRRSSSCTRLARISCISQNGLASV
SQCGHRYVEVNARDAARSRIARVVGGFETVPGAFPWTAALRNKETKAHHCGASILDRTHL
ITAAHCFEEDERVTSYEVVVGNWDNNKTDGNEQVFNLQRINYYPLYKDIFSHDIAILEIP
YPGIEFNEYAQPICLPSNDFIYTPGRQCVVSGWGSMGLHYAQRLQAALIPIIDRFDCVNS
SQIYTSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPG
IYTMVAPYLSWINSVVNGGTR
Download sequence
Identical sequences A8WRC5
CBG01571 6238.CBG01571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]