SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG01939 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG01939
Domain Number 1 Region: 307-480
Classification Level Classification E-value
Superfamily Fibronectin type III 9.02e-16
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 2 Region: 190-273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000361
Family Fibronectin type III 0.0073
Further Details:      
 
Domain Number 3 Region: 508-583
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000102
Family Fibronectin type III 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG01939   Protein: CBP06222   Gene: WBGene00025103
Sequence length 680
Comment CBP06222 WBGene00025103 status:Predicted UniProt:A8WRM5
Sequence
MKLLIFLLLLLETTVALPVPIVKDPRARIVADLDIIYVEWQSGPQPQNTMYTIRHKTGSD
QVAWKYIKTGESNVRIPLGTYADGDAVHIQIKTERGAQVVENWTKEIVVNVAKKSVRSAP
FRPVALAAPAAPAAQPAPAAPAAPAAPQPNQHANQHANQHHAHQHHQHTAPQHPQHAHAP
PQAAPLVHASGALVPPLHFTANIMNPTTVQLSWQPAMPGRQDIYYLVNVKQLTTASGSTL
QNQQIKTAATSFTLGKMIAGEKYEMTIRSATSQDTVSGTASIVEITMPREDDYFEIGNLI
ISSHFRTPTQGIVNLTWEVPPTMANRIASYNVEYAETGNNRYWQKIQFHGASSSAALHHL
KSNTEYLLRIKTALVNNIVTESGQFRFRTPRVETNPIHKVDVIYSHDVNSVKLQWMLEPH
IRPENVAGYDVYLSQDKDLPDSQWKLVRLNNKESHLSLEDLKSSTVYFVRVNVRNTDGSV
IRAPSVYRFKTIDNTDEEEFEGNSLAYRNVAPGEVEIRWTFPKSILDSVIGATILYTNRK
DLTPEQWQKIEIEDSKNTTVLLKNLQEGVRYSVQIIPRLYTGDYDFESRELFEFKTDKMS
SRDVNHGTDVRTLTPHGHPLASPHFEQMSHSETEFMRIVSCNPDEIKSGCAWDEICINRV
EDRNKGWCISNTLRDSILNS
Download sequence
Identical sequences A8WRM5
CBG01939 XP_002643744.1.8413 6238.CBG01939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]