SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG02405 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG02405
Domain Number 1 Region: 824-1125
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.22e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000992
Further Details:      
 
Domain Number 2 Region: 1185-1464
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-66
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000204
Further Details:      
 
Domain Number 3 Region: 410-468,499-537
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000569
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 4 Region: 188-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000417
Family I set domains 0.031
Further Details:      
 
Weak hits

Sequence:  CBG02405
Domain Number - Region: 544-597
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0466
Family Fibronectin type III 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG02405   Protein: CBP31436   Gene: WBGene00025464
Sequence length 1471
Comment CBP31436 WBGene00025464 locus:Cbr-clr-1 status:Predicted UniProt:A8WUE3
Sequence
MRINRWIWWTTVILLYLRTELLQAADFFRSSAENEKTKDNIDNWNSTKIEPKPPKTAKEL
GNLKILESVHVCESNQDCVNGGVCHRGKDGHVSHILIPFPRYNPMLPVVPPRCGNRRSTA
PCLVMDKDYRSKYDLRDPTCYMNGCVCPPQFDTVYVTADQKPLRLNSTLLPTKCDKRDLA
VVGRVHPSLSVFKGIDVTMFCCVNLDPEGFIDVANVFFIQNGTLMREPTSHPFSPSTRGG
IARRVHEKQSCWELEIKNVQTSDSGTYMCRVTASAPDLDVTDTMQFEVKEHPRRTHSYWY
KRPKKVMSPSSALKNSDDDVVPSGYLPPRQISKLNVTASERDAIVTWESEGEEMAIDLRL
VRRSDTRGAVVYRGDNVTSPVVVKDLRAATPYTLFASGKDGSVPFELTHHFTTGQKRPFP
PKEEDVRILNSGSSLSCEVEWKTPAETNGRITKYFVSVRGAMRKSDGTLTPDDFPSAEEV
DKRCANWDEDESKSAQNGINPIDFSNDFYSCKFGPLKPNRNYSVSVWAENSAGRSLPAVF
KKNCVTNFAQPDLVETPQTLRTANMTTFNLAFSHPPDDMNGPISCYYIAIVPLPTNVSLD
LLPETNEIVMDSFTKVYANNLHSSAAEKKRFFAYVAESYTELPMETVIGDGLGVSGLKAC
NVRYLSRYTAEDLALRNGLKYTGFLIVRVDKEEEVNRKGGPSGTNGSSIYRNLIDKSSPT
TERSRTSSSATRHLRQLHLSGPAYGYSGYFKPILLDSNSSSGGYGVFVKIVLPILIFLVC
ATCLSLFMINRKNQFLSDWCPPFISKMASKDVVERTLLKQTFGAIPVEDLPTEYVTRHRD
SDFLFVQEYEALPHFPMNTVASNRKENAIKNRYNDIRAFDETRVKLEQIRGDEHSDYINA
NFIKSWKEKKLFIAAQAPVEATIDDFWRMIWEQKSELIVMVANLTEKNRQQCAKYWPDEE
ISRYGDIIVEPTSVSFHSDYVVRKFDIAHIAECGPDVILNENGVEYANVPIVKGQFAENA
RHILQYHFTNWNDYKAPECSTGLLRFMYILRELPEFNNSPVVIHCSAGVGRTGTFITIDS
MFDQCLAERKANVFEFVCNLRRQRNLMVQSVEQYVFIYKALAEWHMYGYTDMDVADFEEH
YQRLLCESTAASSSRDRAVSFNQSSSGNGSISTRVAIVSSRESILTSNSETGLEEEFKKL
ERNLATGLPTSFASKEENLLKNRYEAAVPYDKYRVILPPTIGHADSSYINASHIKGYFYD
YIAAQDPVGTSSSTVFDFWRMIADQKVTTVVMLSDENDWSDSEKYWPIEGPGTDCHFQEG
RNAIDVSCVSLEQHQDFVVRHLTYTMKNADSTSPNQDLTQYSYTAWPTEALVPRSPNSLM
NLISLVLQRQSNLLESRAPIVVHCRNGSSETGIFICISLLMLRQKAEQRIDIFQTVKGLQ
SHRPMMFTRFEQYSFCYRALADYISQTLLLR
Download sequence
Identical sequences A8WUE3
CBG02405 6238.CBG02405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]