SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG02994 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG02994
Domain Number 1 Region: 894-1191
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.25e-107
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000051
Further Details:      
 
Domain Number 2 Region: 1168-1455
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.76e-89
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000288
Further Details:      
 
Domain Number 3 Region: 37-231
Classification Level Classification E-value
Superfamily Fibronectin type III 4.06e-27
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 345-531
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000212
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 5 Region: 237-336
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000799
Family Fibronectin type III 0.0012
Further Details:      
 
Weak hits

Sequence:  CBG02994
Domain Number - Region: 508-602
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0232
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG02994   Protein: CBP00623   Gene: WBGene00025942
Sequence length 1462
Comment CBP00623 WBGene00025942 locus:Cbr-ptp-3 status:Predicted UniProt:A8WT15
Sequence
MGTPTIPWATINKVRTTLILVFLLLTPSCRGEQKQKVPSSPRNFNAELTSATSVKLTWDA
PAAANGALLGYYVYLDRIINGEPAVDKNSKKRMVMIKDSTKRYWELDNLDPNTEYSFRLN
GFNRNGDGEFTERKNVVTQGIPPEAPEITSVSLDRDEPPVVSRIEWKMPKMKPNETPIEK
YNLWLRPQGYPDSYIKSKTVDGTDLSTTISGLWMGVVYDVLLGAENREGRSQNATETIAT
PVGSPDGEPIGVQYEVMKGKIVVSWRPPPEEKRNGNITSYKAILSAMDESTDRFEKMVPA
SSTSSTFEVNVRRAYLFKVAAATMKGIGPYSPVLTINPDPAALVGPPTNVRVEATSNSTA
VVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLPVLSIDKENPKRFAIVSDLNAHKPYA
FCVLAVKNNRQGPCSDPPTVLESVTPTYMVQNLRVRWKTSGSVQLTWDYNGPRNVGFYVN
HTGKKDYMNHELLEKTMSTPGFGHDLDEKTREYLWTNLRPHMMYTIHVGVRTLPPGARKY
WPQEVVTVTDPTGPPFVDVPQLIESSGTQPGQHMIRLTPATEEYGPISHYWIIVVPANYS
TEDVVNLDSIDLEKSTAEKRAQLARSLSVSPSKKLKRRAEFSEDRSHPKEKRARRATVPG
AYVTARLSADRVRQFYRNNQPFVVGDSKLYDGFTNYPLEHNSHYRLMMRAFAKNDVRAKD
SFEQRAPMSEKLSRMYSDSLLTEPFTIKSALRGASQKSSPWVGACIALFILLSIVGMLVC
WWLRCNKKSAGRHPRHGSITKVALTGNIMNGGGMPGETSKLLSTSNEYGRQIMNPYEQMN
GNHHMESSLDLYPLPRSHSRTNGYAPVPVPLPSLPNNGNNMTTVAHPAVPIAELANHIER
LRMNNNIGFQTEFESIETGQHFTWEHSSAEMNKHKNRYANVAAYDHTRVVLSNVEGYPGM
DYINANYVDGYDKPRSYIATQGPLQETFADFWRMVWEEQSVTIVMLTNLEERSRVKCDQY
WPSRGTSSYGDIEVTLLESVHLAHYTMRTMRLKMIGEPEVREIKHLQYTAWPDHGVPDHP
TPFLIFLKRVKTLNPHDAGPIISHCSAGIGRTGAFIVIDCMLERLRYENTVDIYGCVTSL
RSQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHVQALMQPSADQMSGIDMEFR
HLTTLKWTSNRCTVANLPANRGKNRMLSAVPYDSNRVIMHMISGIDGSDYINASWIDGYK
ERGAYIATQAPTNETARDFWRLIWEHNCPIIAMLVQTRERGQDLCSDYWPLETGVQVGNL
VVEPMAEYDMKYYHLREFRLCDIHTNETRTVRQFQFMEWPEVGKPHKADHFLDFVTQVHN
TYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQE
PDQYHFLYQAAYEYLAAYDNFS
Download sequence
Identical sequences A8WT15
XP_002631199.1.8413 CBG02994 6238.CBG02994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]