SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03042 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03042
Domain Number 1 Region: 41-415
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 8.11e-59
Family beta-Lactamase/D-ala carboxypeptidase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03042   Protein: CBP35060   Gene: WBGene00025983
Sequence length 429
Comment CBP35060 WBGene00025983 locus:Cbr-lact-3 status:Predicted UniProt:A8WSX7
Sequence
MYSSSSLFRLILGTVLLSVAYRFFCDRLYSNHKPEINGFVDERFTKVREVFMKNFEKGWE
SEGSAFAVFVDGKKVVDLWGGYADKQAARKWAEDTITVTFSTTKAAAALAVALLYEQGKL
SYDDPVSKYWPGFGTHGRDNVTIQMALSHMSGMAWFDTPITEEIAADHEQMRQIIEKEEP
KWAPGTKTGYHAYTYGWLVDQIVRHTDDRKRGIGQYFREEIASKLDVDYHIGLPLSEQHR
VARISTPNMLNRIDEMLTDIRVLKYMKSLIKLMTDHPLAHIVKNPSWLEAVSRCTINNPD
YHRLEQAAALGMGNARSLASLFDKVSRGQLVNQATLNTISKPFVNESDFIFDDTVAKGHG
FFHLPINRAGAQFGFGHTGHGCQMVITDLKNRVTIAYVTNGLKTGLYDLCRTYWGLQSSV
YDVIEQVNN
Download sequence
Identical sequences A8WSX7
6238.CBG03042 CBG03042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]