SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03226 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03226
Domain Number 1 Region: 438-607
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000443
Family Fibronectin type III 0.0069
Further Details:      
 
Domain Number 2 Region: 97-183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000292
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 3 Region: 336-495
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000578
Family Fibronectin type III 0.0044
Further Details:      
 
Weak hits

Sequence:  CBG03226
Domain Number - Region: 15-82
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000526
Family Fibronectin type III 0.0057
Further Details:      
 
Domain Number - Region: 631-698
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00276
Family Fibronectin type III 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03226   Protein: CBP33631   Gene: WBGene00026128
Sequence length 889
Comment CBP33631 WBGene00026128 status:Predicted UniProt:A8WSI2
Sequence
MFLLIFLLASYNSIASSSSILVDFTSHAIQPTPQAYIIEYSPPVGYPPSGSAVEGTTFHS
LINGTISATEYTVSVSAILMDGTRQNVGELAVFSSPDAPTLDSIETTEHEATISYFPPQG
QNITYHIEYYPEEHKEYSNAIDTKASLVRLRGLDSGTTFRLRIRSVYQGVFSQELIDSTF
VTQGTANYDYSSSAELYSVRTLPPNFNLGLQTTTEMTSYEYSKEVEEEPSITTPLVSVIT
TTSSPEPSFFTSTKLEQTTTNPITTETIPPSTTTSTEATTTIRITTTTTSFKPKAAPVEV
NSGDLGEDHPTENSNALVDLSEMFQEYGHPSEVYLSNENEMLRLDWEAPENANCEAFFVN
YTILTLSRPRSFSLATSDEHANIKMFPEHTLDIRVFCMLAGALSKTWWAHRIAHLSKPKA
LENARVAEVNTDEFYVASIKLMWDWPVYHDFERYKIVISYGIGRADSKEMEVTNKEEFVL
LDKLEPSNQYSISVRNASTELSLTSKATQLEQVTAPIISSTVYPGQISSNSININFGDSD
PEQGRFDYYLLTFSGNNKNISKKVEMEHELVKGSGYNLHSSFSRKSFTFTKLIPGKTYQF
SVYTVYKGVKSRPVSADITTYPLKVNQLFPVVGKDYVVLYWDIENFADSDCRFRLSYNAD
NIPTVSVELKGASRHRFSGLKAEVYYTFTITVIMGIGQAAAESESEMIRRELVVGFDNDL
SVFSLLNGSPDNFAIIVSDDTSLNDDNYELKSWFEVKDEDVWGAYRASPSTWNPFDSERV
RRAAFTVGTDDCVKRNLDEPYCNGILRAGTDYRVKIRMYTDTKVAMETDWGRIEGAKDSD
DEEEDEEDEEDDRRFPCHMYLNGCRRKAANNRLSLIPFFISILITFFLF
Download sequence
Identical sequences A8WSI2
6238.CBG03226 CBG03226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]