SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03240 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03240
Domain Number 1 Region: 1068-1354
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.12e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000168
Further Details:      
 
Domain Number 2 Region: 531-734
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-25
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 163-291
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000025
Family Fibronectin type III 0.0094
Further Details:      
 
Domain Number 4 Region: 701-810
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000267
Family Fibronectin type III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03240   Protein: CBP35656   Gene: WBGene00026141
Sequence length 1385
Comment CBP35656 WBGene00026141 locus:Cbr-dep-1 status:Predicted UniProt:A8WSG9
Sequence
MIRWKYGIHYLIWLLLVLHLSTCQSDSSLTTSAEQHELFAIKKDSLSPWSQILVSLPRRH
PLYQSFAAKIQDVTENISDDVRDANKTFVSSDDSPYNIRIHALKPGHRYSIAIHGQKDGS
TSLIKEESVVMDPRAPDFRSIDSDIQVAEHNITMRTIKNDSYLQDSFSIEYRQINPDKKF
PVLQILDIPEQKNLEFYLGNLNSGFDYSVRVIAHKDGISSRPWISTLTTKPSPVKAVNIN
QNSGSCVEVTWQTDEFSGADFYTIQYALQSNPSNSTNMTIPSTESSISICDSMLQGEAYQ
IVATVQKGGQVSDPLLTKFQLRPLPPIDFRVRADLKRGKYKMLAELPTSSKIDKCQITVA
GDEVERSINYANIEQTKSGHRICWFNFALSPGERFDFSISSISDESTSQKLQKSIVLTPA
FDFNAFGLTLQESNGGIELIWPKSEVFMSRVKDIWNKVVGSDSLLNMRITPIGSIDNTDK
TLKFETSPKNLDPVFAKNLVKGACYRVQLFTVTKTGIISETRHNETIRMSSPAVNVSLES
VTRSSATLRIVFATHHDSTSISNCQMHIVVRDMNGKSVFDKRMQLTSTFAPLLNLDGLRP
FHKYTVNTQIICGGGHETPQCPAATRTMRQLSFSTRQDKPAAVQNLKVEPLNSYSVMLTW
LPPAMPNGILTHYNVNVTKMGSDETRTIDVGVSSNRSDHTVQVIVDELFGGHTYNFSVRA
VTEAGFGETSPVIPSVSMPLMAPPKPTAAPMIMKESVGSHSMIVRFPTTMFDNRNGEIKQ
FAIIVSETTADDSINRWLETDNGTYTWQQVQRFDVWPSFVAKLQDIQKVKQDADVSIFEE
LGDDESCREVRADRICNGPLRSASKYRVRIRLFTSPTLFTDSPPSQVMTTAFLSPRSSAT
PAIPFVTVAIVLTVIVFAGIVGTVFLLFWNRTKKARHIFISRSNCRLAAAAFKNGPSKEK
ESQWEALKMMMAERAADCLAKLGLDATTPPPSSTTTSSNSPTSTSTTMTDCGSNPHLGAP
NANAGGHRRTRSLRERTGVEHRLERLSSGPIHRTPLYTVVSGANTNKSRPVRLEDFAEHV
RLMSADSDFRFSEEYDMMRNVGVGQSVAASELTVNRPKNRFTNIPAYDHSRVKLSNPNNI
EGGDYINANYVPGFSSRREFIAAQGPLPSTRDHFWQMTWEQQCPAIIALTKCVEKGRDKC
HQYWPDHENVPVLYGDIEVTIMAEKEYEEFVIRDIRLEKVGPEGRATRYVRHWHYMAWPD
FGAPAHPNGIIQFSRMFRHQLPHSPHNEPTIVHCSAGVGRSGTFISIDRLLQTSSLGEPI
DVFGTVCEMRYERCQMVQNEQQYIFIHYCVLQVLQGSSPSPTSSSSGAHHNAGFVQDGMM
VESGF
Download sequence
Identical sequences A8WSG9
6238.CBG03240 CBG03240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]