SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03342 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03342
Domain Number 1 Region: 14-64,159-199,303-404
Classification Level Classification E-value
Superfamily Fibronectin type III 3.95e-28
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 2 Region: 551-744
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-22
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 3 Region: 846-933
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000161
Family I set domains 0.058
Further Details:      
 
Domain Number 4 Region: 1035-1122
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000251
Family Fibronectin type III 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03342   Protein: CBP32228   Gene: WBGene00026220
Sequence length 1255
Comment CBP32228 WBGene00026220 status:Predicted UniProt:A8WUT9
Sequence
MNYENRRFSISVPYPDPPTSIEVNPVDHDKLSVCWQEPEKHESNKMFPILDYAVYYKEIP
NFPLLGGDMGLPLLTGDYSDIGDIQEDEYQQEEDDAEEVVKDSTIAPRGKRDVDFESDGI
KVAVREKRSTMVIVTRDDVTNSTTIREFAFRNINTTDKCVTLPDLRSATRYIVYVTARNE
YGTSVPSVRNIASTNVHMVKNNASLPDAMKCCTAANVSSFCSSKMCNVAEDPSSFSTITI
ATTCRAEWPKVSPCIADGRNHTDCCLKKGVQHDCLEICSGSTKELGVHSVLCLNLDLQAI
YQCIRQGYETHPSAPGNVTISDLTAHSVTVHWTEPDSNAHLVENYTMFIRKNEHGEPVRT
VHNVQSPHVELGLDPDSEYVLTLQSHSTNGTSLPSTAKLFTTLPTTRPPLCTIGEPIYMN
DGRVMICDNVNPCPNGFRCTGAGSDLSYCCPHDGTHSSEEFTSCCKDQKMPEKCMNSCQY
NSTLGEDCKENLNIWVQCASEGHDHLRCCMREDVSKPCQTACMHPFTVSTDECFAEVPKY
RTCFNGLHLALPAVVRDLEVTSITKDSATITWEDVEANVIVFRVQLFASNGSLVNTVNST
ADIYRFSDLSSATNYSVRVTAINLQGEGPPSWNVSFVTRPAQVYDGDRPVAPDGLHVAWN
SGPRVNVTWNRVTVRRNNDPVSHPIEYTLYYLETEHSSTWTTLKTNNTWVVMRDLRKDAL
FYVYVTAKEEDKISRSSSIITVLAQKDSLGLPEPVITIEPDHKDGVLMPGEKITVNCSLP
NAKKHLNIDLTVGHQVVQNDHGVFWVILDTEADESIDTATCAVSDTDGRQHVAMKHLVLQ
RKASVTMKKDKIRVLDDQSVEIECIYRGGGLDPKISFEKDGKKATRGFLNVKQTEAGYVA
KWRIRKVKQDDAGIYKCVVTSEDSEPVEASSEVIFTTETLPVNPKMILQCCEDEGITGDC
LQACNIGRVALSAKTQNCSRFATSLLKCASDIRDHSDCCIASGVTPKCLPLCSGDSFSKD
VDCSDHAVSIMSCFVKSHEHAPTKVSNVRVKSSEGKVNVEWDYPLTKDYKYFAVYYRKTN
NAQDDDWHKLKTVQQNIEIELDTSEDYEVGILAANALGNSPLTYAAVPKDSDSNRSPSAK
GSSSAFWIIVILVVFGICIAGLAVLGKRRELPYPFGKFIGRRNDPNQPTVAFENPAYGEP
WGGPEVEIRGLGGASGAGGAAAGQSEWQSANLEANNATDNSHEYRNGMRYAKLET
Download sequence
Identical sequences A8WUT9
CBG03342 6238.CBG03342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]