SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03355 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03355
Domain Number 1 Region: 852-1033
Classification Level Classification E-value
Superfamily Fibronectin type III 3.71e-30
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 2 Region: 640-835
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-21
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 3 Region: 339-437
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 255-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000106
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 439-529
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000232
Family I set domains 0.0082
Further Details:      
 
Domain Number 6 Region: 555-644
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000287
Family I set domains 0.037
Further Details:      
 
Domain Number 7 Region: 148-226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000156
Family I set domains 0.022
Further Details:      
 
Domain Number 8 Region: 61-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000157
Family I set domains 0.004
Further Details:      
 
Domain Number 9 Region: 1030-1122
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000019
Family Fibronectin type III 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03355   Protein: CBP36614   Gene: WBGene00026230
Sequence length 1216
Comment CBP36614 WBGene00026230 locus:Cbr-lad-2 status:Predicted UniProt:A8WUU9
Sequence
MRLVICNFLLVAQVLAAQKSSIGKFFGERLKFKNSNLGPPKLRDQSEEEVWYHLDDDDLK
NRLTLKCDADENTDRYSWLKDGEPFEINSDDVVWQKESQSGSIVFMKPHISHQGYYQCFA
SNIFGTALSNKMHLRLGSLEHFPKREIQILKIKEGESLTLNCTPPRGIPPPKIIWLYRSL
DDSSVIETIRSRHITVDNNGRLHFSSVELSDGKPTLVYECAATSPILRGEYRSGDRVQLD
IEPSQDKSYPVKKLSVSPSEVTVRAGGQLKLQCVFGGRPLPTIFWSKVDGELPKSRIKDL
TTHESDFGRSLIVENVHPDDAGVYECRGRHLVHTVNVRVMAAPFWEFEPPRDISLPEEST
GELECLAGGQPTPIITWSMNGKFLHELAEDSRRVLLDHGRILRVRSLNHDLDTGVYQCNA
SNPLGYVFANAFVHVRAHAPFFRMPAARHWKVVLHSTVILDCDVDAAPEAIVRWVDADDR
PLQVVEGKNKLFPNHTFMIYDVNSADEGLYYCNVSNKYGINRATNRLQVFSECFLRFYLP
DYYFLEPTYFVRIPTPKRLILEAGETAEVFCEAVADPRLPIKYQWTINGKVLTESKYYEI
LPDRLRFRSVRGRHSGIIDCAAITDVDVKLASMQLIVKDVPAHPVVEAAHCSERKATIKW
VAASDHGDSIKKYIVEMFTDFKKNEWEVINEEVNVNKENFEVDITLTPWVNYTFRVVAVN
SHGRSDMKIDGQSKEDWLTCQTRPSFPYTNPTGVKGEGTEPDNLVISWKPLDRYYWNAPN
MQYLVRYKLDEPIHGWTEFLVEDSLANFTIIRDQPTFRKYLIQVQSVNSVGPSIVEPEIH
HGWSGEDVPDEAPRDFRIDTQINFTTINFTWNPVHENIVNGHFVGYEIEYWKTENTVRKY
SIKIPANSTYKIINSFHAVTNYSAHIRTRNKRLRSAPSLPVSFAMPEGPPGKVHNLRVYS
VGSTAILLQWDAPLQPNGRIRGYFISFQNDKNETEETYVIHRQKYYLHEKSEPDTGYKVT
VWAETRAGEGPTTLRPVRTWPPRIPDAPTFRVKNISLDSFVVEWLPNNHSVWKMPGAAFF
VNYTAESSNTWHQSEIIYLPNTEILLRNLKEDQKYFIQGIAKDGPRQCESVFLPIKTLNR
DYANRLKEDSLRSAAWFIAVLGVLGIGLFTICLTFCCGNKNRQDKFAVRRKEIEIGHQQD
NEEEKQFLEYQYGFKN
Download sequence
Identical sequences A8WUU9
6238.CBG03355 CBG03355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]