SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03362 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03362
Domain Number 1 Region: 179-275,398-451,484-514
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000299
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03362   Protein: CBP06499   Gene: WBGene00026236
Sequence length 536
Comment CBP06499 WBGene00026236 status:Predicted UniProt:A8WUV5
Sequence
MMLKLFLLFICCLITLCKSFHITPISYTLLAENIESVVNLAGKVQEKRFFLQISNEASPF
FMYVTPCGAPIHWQLFSVDKDMSLSEELDVVSSISTPLEESEKFRLIAGEEDKKRMTFFA
HRVPKKVILVVRASSPSASARIFFSPSLFRLEEQYPPLPHDTRLATNVLDDISKKDEVSA
QITWKISPQVRNAEPGRYRICTIVSRQDPEFAGMCDDVEEGVEAVKCVPQMNNSVVMGQL
WRDRTYYVTVFVRDQKRGSSSAYEVQTIQTPPSPVNEMVSRRKVPRNIPRKQKKNAPIIL
TDGIMGQVELEPRKASVLNMKFFVHPLPSNQSQTAYLIVHACDGLIRLNLFRNGKLLKRS
ESFSGFKRFVVSNFKAGHLRYQIINDDDAKKTIRVWTSTNAAQSPYPNLPDDTSVKVVNR
KCDSATIQWMRGQDEHLKYCVYQRKENSNFLEHLVSLADNLCQGGLSSSTLVGCYVHSPT
SAEIETQSVLETIIGNLQPSSTYRLDLLAIPMNRPHPQALPYRTVWVRTNPYCAQE
Download sequence
Identical sequences A8WUV5
CBG03362 6238.CBG03362 XP_002633683.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]