SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03399 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03399
Domain Number 1 Region: 709-1000
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-85
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000268
Further Details:      
 
Domain Number 2 Region: 190-393
Classification Level Classification E-value
Superfamily Fibronectin type III 1.99e-29
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 1014-1244
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000000166
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.007
Further Details:      
 
Domain Number 4 Region: 386-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000338
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 5 Region: 132-194
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000109
Family V set domains (antibody variable domain-like) 0.043
Further Details:      
 
Weak hits

Sequence:  CBG03399
Domain Number - Region: 496-570
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000834
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03399   Protein: CBP34054   Gene: WBGene00026268
Sequence length 1247
Comment CBP34054 WBGene00026268 status:Predicted UniProt:A8WUY8
Sequence
MLRKHFIVFPFLLFWNHHLVESLSVTSKNATEALLRCPPAESFIRTHMAPDFETPRLVRR
LDWFQDDSLVASYQQGHVEGVEKELEKKKIGLDMPHISVDGHQNFHSFLNSWDKKKEKMV
SLNIGRLADSSRQWWVADGRYQLIRPFYTLRVSPVTPEDSGTYRCRLETDPLFSSPQSTA
TQELAVMVRPVAPSSPEIKSFTNRSITLVWTHNAARAHRPILRFSVSVRTVPFASYCPPS
IVNFRFVMAAPSNATTVIVDNLSPYTLYAFSVRAENSAGSSDFGPETTFRTLGEPPNRAP
QIQKIRNVTSECVEVTVTPPDEMNGELEKYLVLIQAVNETNPRKMTFDKPTSTPLTICAL
TPSSEYALAIEADNGFGTSPQATLVFRTEDSVPNWSPSTIKTTPVVGKPEIIVLWLAPPM
NATEKVVKYHLYYKANNEDQWKIEHLNVNPNEVKSKMFKYRLVDLNPNTLYRIRVSASTS
KGEGSQSADSLAQTDVGEPGTVIFKDLNFDCKNGVKLSWNYEPSVNSKKSPTFTVKITNQ
TTSLQFNTTRQTLDIIDLSLYDEYSLRIIVLERSTIDNTTILIGKYSDNHRFILKDKCAY
QSSFCSPGEKCAKLTSSAANPQYISVLIVIFAIIIFAFICFIIVHFARGSMNFKHLLKKK
EKCVYLEEISPLVYGRLNRSDMISMKCYCLDSAGQEDIPVELFYGYVEDLNRNDALKFKT
QFQILETQTSGIDQADSGESTSSADENSQKNRYNNIGAMEATRIRLNSPTGNDYINANYV
DSCNERNAYIATQAPLPSTFSDFWSMIWQERSNVIVCITNMVEDGKVKKGMSYFPNSIFR
FQRKCDQYWPSVPDSPQNFGNYQVTLISESTNAHFSHRVLDLKIAKSVPAAERKIHQLHF
VGWPDHGVPSSVFPLLNFIHYASDIHSTGPVVVHCSAGVGRSGSYILVDSMRRHLISFRR
LNVQGHLTHMRRQRAKLVQTLEQYIFCHEAIRQLIRHGITRVHSDLFMRYLHYLSEENLN
GKTRMQLQYEDVCECKHQPRCLIDSDVLTLPGYHRSDEFMVGSWSHECEELWKLIWKRKV
QTIVVLNQRDSFWRKLHLCEDIQLQHGDNFVLMQREDQQLCVRIMNVARSDLDADFWREI
ENVQKQRITYHDAPLLILAQKFPPNASSPTDSTSTLSLSMLFNDDSSLAFSICAATTLAC
QLETTGCVDVVQVLSSYTEIQCGIFSSKQEIEIIYEKISQLVEGTRV
Download sequence
Identical sequences A8WUY8
CBG03399 6238.CBG03399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]