SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG03794 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG03794
Domain Number 1 Region: 392-657
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-30
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 2 Region: 149-187
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 335-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000753
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 4 Region: 86-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 5 Region: 207-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 307-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000189
Family EGF-type module 0.016
Further Details:      
 
Domain Number 7 Region: 43-83
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 738-777
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  CBG03794
Domain Number - Region: 264-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00168
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG03794   Protein: CBP27825   Gene: WBGene00026577
Sequence length 929
Comment CBP27825 WBGene00026577 locus:Cbr-rme-2 status:Partially_confirmed UniProt:A8WWR1
Sequence
MPIFIHFRNYFITKRAMRTAWFLTLFTYLLIKNTTQAPVTNTTCDLEKEFDCGSGSLRCI
PAEWQCDNIADCDNGKDELGCTYAHHCGKGFMLCKNTVCVGGEFKCDGEDDCRDGSDELH
CEYNSRRSRSDRVAPSPFPNTFVGHNGPECHPPRMRCRSGQCIQADLICDGHADCTGGDD
EVNCTRPNIIGIQMLPVHTDSPLKDECRTGYTMCFSGDVCIPNSFLCDGDADCDDKSDEL
NCELNAPNEEQFLSGQADHMHSCSAAGKFACETKGTEMVVCLPMNSTCNGIKECPFGDDE
SRHCSECARTRCDHTCMNTPRGARCICQEGYKLADDGVTCEDEDECATFGHICQHFCEDR
LGSYVCKCANGYELEDDGHSCKYETSTTSEGYLFISLGGEVRQMPLADFHDGSNYASIQK
HSGHGNIKSIDFMHRNNKMFMAISDDQGEPTGELAMSENGLLRVLRENIIGVGNVAVDWI
GGNLFFTQKYPSPSVGVSVCTMNGMFCRRVIEGQTQGQTYRGLVVHPMRGIIVWLESFQK
LHRVMMANMDGSQVRVLVDNKLESPSALAIDYIRQDVYFGDVERRLIERVNIDTKERRVV
VSEGVHHPFDMAYFNGYLYWSDWGSETLKVQELSHHHSSAHVIHSFNRFPYGLAINHSLY
QTGPPTNPCLELECPWLCIIVPKTDLITTAKCVCPDGYGYSIFDNSCVPPTTNEEKNKLE
NLSHIGAALMAEYCEAGVACMNGGMCRELQNEHGRTHRIVCDCEEPYDGEFCERLNPEML
AALEEAGTPAGIIALVLISLLILVVIGCSAFFWFAQRELTNDVISTARVHVDNMARKAED
AAAPFVDKLRKVTDRPSSSSPKDGCHSATNVNFVTDETTAERRVRMQTSPSSYGNPLYDE
IPDVSSGFTISSSAPFAGVIRFEDDNSLL
Download sequence
Identical sequences A8WWR1
CBG03794 6238.CBG03794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]