SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04193 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG04193
Domain Number 1 Region: 188-252
Classification Level Classification E-value
Superfamily RING/U-box 1.79e-20
Family RING finger domain, C3HC4 0.006
Further Details:      
 
Weak hits

Sequence:  CBG04193
Domain Number - Region: 5-27
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00544
Family Di-heme elbow motif 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04193   Protein: CBP35544   Gene: WBGene00026918
Sequence length 271
Comment CBP35544 WBGene00026918 status:Predicted UniProt:A8WWE0
Sequence
MPQYFCHQCHRSFDIDASAAVACTRCHGEFVELVNRPAMIAAAMPGGFQALNQLAEMFRN
GMERFGAQQPAQPTEGAEAAARAEAGGNAPAAGEPGNEGSALREFMDSMFRPEQRNGDGP
QNVTFSFQMPGGVGVQIHTHRAGNGQDGDNDQADLDTTMAEILAQFNGGEGVGAMVQRGF
SENEIREYLPMKKVTKEHIDNGAQCTTCFDTFKLGEDVGALDCNHIFHRPCIEPWLKTKN
SCPVCRQKVDMHDWKIRHQRQAQEAVLEDLD
Download sequence
Identical sequences A8WWE0
CBG04193 6238.CBG04193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]