SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04264 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG04264
Domain Number 1 Region: 228-520
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.2e-105
Family Glutaminase 0.0000119
Further Details:      
 
Domain Number 2 Region: 547-632
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-16
Family Ankyrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04264   Protein: CBP26594   Gene: WBGene00026975
Sequence length 825
Comment CBP26594 WBGene00026975 locus:Cbr-glna-1 status:Predicted UniProt:A8WX31
Sequence
MFEFLTQKIGKKSKVKLPQITQITVKMSMMDNVAEKGGIFDALRVDSNDPNDSLREEAST
TPKIDEKNLEYIGEVLERKKSVVPFLTQTINQLALVRNEKMERAADLICTLFRLPHGSTD
CSFFRLIKVLRSFGIWENDPRLKQMFDRMKKHDEENEDSRQWAMSQEKFKEIIFPCTILI
SRTLRNQLIIPSWLEFTQMIDTIFESCRESKEGELLCFYCDLQYLFCREVASYIPQLARQ
SPHTWGMSICTIDGQRFSLGDSKKNFCLQSVSKAFNYAIVASEIGSHVLHQYVGHEPSGR
LFNEICLDSNNMPHNPLINAGAIVVTSMIKPTHSMADRFDFMLKQYRKLAGGGHVGFDNA
TFLSERDTADRNYALSYYMKEYRCFPDESQVYEKGLREELDLYFQLCSLETNCDTAAVMA
ATLANGGICPLTTEKCLGSRPCRDILSLMYSCGMYDYSGKFAFQVGLPAKSGVSGIMIVV
IPNVMGIALYSPPLDKTGNSCRGVAFCRQLIDQFNFHNYDSLLHPDDSRKIDPRRKIGPR
ENETIVQVMYAAKNGDLDSLRRMFMQGADLKTADYDNRTALHVAAAEGRIKVCKFLVNIV
GIPHDVKDRWGRYPLDDARQFKNKEVALYLFRLQYPTKRMPENWFEVGGDLLVSELENAA
DNIDDNVESSGEDEGITGMLTDDLEKREWALHANGNMGEINYQLVRRKSSKAPPTPEQKP
LTFGYGSLAKHHPEKQHHHEKKKHHAPQSQHEPPQHLFHNGAGGHHLNGNGVHSNGHHHL
PSHVMMLNGAAGGLNSRRLSSPMEQDEDNVRKSSSSQDLMKSLDV
Download sequence
Identical sequences A8WX31
CBG04264 6238.CBG04264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]