SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04582 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG04582
Domain Number 1 Region: 83-218
Classification Level Classification E-value
Superfamily Fibronectin type III 1.31e-16
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 2 Region: 236-438
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000206
Family Fibronectin type III 0.0053
Further Details:      
 
Weak hits

Sequence:  CBG04582
Domain Number - Region: 575-639
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0558
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04582   Protein: CBP37505   Gene: WBGene00027225
Sequence length 683
Comment CBP37505 WBGene00027225 status:Predicted UniProt:A8WXZ6
Sequence
MILFLCREDEDVERVQVIEVRNDAIRIVWTVDSEEVEEKEITKQRLIVAVMRSIGVNQYL
LFLLVFLGSQETEKSSQTVMVDAKLRDYTFVGLAGNTTYRISVEGFNNDTSLWYSSNMAT
TSLAALPWLHAPTDLTLMDRKNESIEVSWIPPVVLEAGHHFVITQHLVKVYDLSGNMSTN
KRSIPVPIPLTRLQIDGLKPATAYNVTVQAGTSYGYGNKVWCAYATLDTDEANILKLRAR
TPNSLTVYWPANWLTKATSKFTIKAKTIHSPTGIFKEIENSAIGEPGKAHEFVVDNLLPS
STYNITITTSDDQQKEGGKKWTQMRWKHGWAVFSTMSQGQYGVAEARIVVETDFAVSIVF
QPLKLPGRIISYQIKYSLKDRNSTRLTDELTDATLKCPKFECQWKCALIFNLPHRPREYK
FEIRAKVDDVWNRWSPVTLRQWNLLERVCSINPPSDLVSHLGDYSRQRDIDVHSAKVPQI
ADVWRYMVVVDSRPYDLAPIDITKLADRTTSEADHVPYYITAALTPEEVKRNGEFRIGDG
KVYGGYVNYPLRSEKDPRWTLIPVTQSENEMIEPYLKTCGFNEQGSFNCDMTLSEVLTHI
PIVLVSAGFLILILVIFFICLAIFCFLRNSCQERPGVEESALMYYRSDSPNTISTCREYR
KIERREFNASDMEERMRFRDHEN
Download sequence
Identical sequences A8WXZ6
6238.CBG04582 CBG04582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]